SecReT6
Protein ID: 239813545
SecReT6 ID348
T6SS typei3
Gene symbol-
Locus tagVapar_0526
StrainVariovorax paradoxus S110
Repliconchromosome I [GenBank: NC_012791] [Browse all T6SS(s) in this replicon]
Location [Strand]579905..580420 [+]
Producttype VI secretion system lysozyme-like protein
NoteTssE
UniProt IDC5CK91
KEGG IDvap:Vapar_0526
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.90E-17, Aligned region: 36..147
Protein Sequence: 171 a.a.     [Download]
>gi|239813545|ref|YP_002942455.1| type VI secretion system lysozyme-like protein [Variovorax paradoxus S110]
MAELTAQERLQPSLLDRLVDDAPTEKRESDDKRTLTKQALRSAVLRDLSWLFNATGFGLAMDDKQYPNAA
RSVINYGLPMLSGQFTSSVQRVSMEQALKNAILQFEPRILSRTLEVELVMEGSALDSHNSIGLQIRGMLW
AQPVPLEFLMRSRVDLEEGRIEIVDMAQNPR
 
Nucleotide Sequence: 516 bp     [Download]
>gi|239813019|ref|NC_012791.1|:579905-580420 Variovorax paradoxus S110 chromosome 1, complete sequence
GTGGCCGAGCTCACCGCCCAGGAGCGCCTGCAGCCGTCGCTGCTCGACCGCCTGGTCGACGACGCGCCCA
CCGAAAAGCGCGAGAGCGACGACAAGCGCACGCTCACCAAGCAGGCGCTGCGCTCGGCCGTGCTGCGCGA
CCTGAGCTGGCTCTTCAACGCCACCGGCTTCGGCCTTGCGATGGACGACAAGCAATACCCGAACGCCGCG
CGCTCGGTCATCAACTACGGATTGCCTATGCTGTCTGGCCAGTTCACCTCGTCGGTGCAGCGTGTCAGCA
TGGAACAGGCTTTGAAGAACGCAATCCTGCAGTTCGAGCCGCGCATTTTGTCCCGCACTCTCGAAGTTGA
ACTCGTCATGGAAGGCTCGGCACTCGACTCGCACAACAGCATCGGCCTGCAGATCCGCGGCATGCTGTGG
GCGCAGCCCGTGCCGCTCGAGTTCCTGATGCGAAGCCGTGTAGACCTGGAAGAAGGACGCATCGAGATCG
TGGACATGGCGCAAAACCCAAGGTGA
 Primer design