SecReT6
Protein ID: 239813546
SecReT6 ID348
T6SS typei3
Gene symbol-
Locus tagVapar_0527
StrainVariovorax paradoxus S110
Repliconchromosome I [GenBank: NC_012791] [Browse all T6SS(s) in this replicon]
Location [Strand]580428..582320 [+]
Producttype VI secretion protein
NoteTssF
UniProt IDC5CK92
KEGG IDvap:Vapar_0527
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.30E-198, Aligned region: 5..630
Protein Sequence: 630 a.a.     [Download]
>gi|239813546|ref|YP_002942456.1| type VI secretion protein [Variovorax paradoxus S110]
MDPRLLNLYEQELRYFRESSSEFARAFPKIAHRLGIEGQEVADPYVERLIEATAFLSARVNLKLDAEYPR
FTGHLLDIVYPNFLAPTPAMAVVSFSPDLDDANLATGPRLPRGAGLRARQAVGQNTHCEFRTSSALRIWP
IEIQRAQYFTYAPDLPLATHPQSRAIRGGLRITLHATAGLNFSQIQLDDLVLHLGGAEDVAWQLQECALG
QPIGVMVRPLSPTGALQGAAQSLPATAIQPVGFEDDEALLPVTATGFSGFRLLQEYFAFPQRFQFLRIAG
LQSVLAAMPVAEVELVLLFSRGDAALEKLVSADNVQLHCVPVVNLFNKRLDRVPLTEGVSQFHLVPDRTR
PQDFEVHTVTEVIGHGAPGADAAAAEQVFRPFYSAFHGTRHSHPAYFTTTREPRMLSVRQRTEGHRSSHI
GSEVYMQIVDPQQAPYAATLRQLAVAALCTNRDLPLLMPLGRDNDFDCVDSFPVQRVRMVRGPSRPVSPV
VSQGLGWRVVDHLALNYLSISDSTPEQGAAALRETLMLYATHADEMRQGQVRGLLSVKAKPVARRLPLKG
PIAFGRGLEVTLEVDKDAFHGHSVFLFGAVMARFLARHVEVNHFVETVLRVAGRGETMRWRPLCGTRQIL
 
Nucleotide Sequence: 1893 bp     [Download]
>gi|239813019|ref|NC_012791.1|:580428-582320 Variovorax paradoxus S110 chromosome 1, complete sequence
ATGGACCCTCGGCTGCTGAACCTGTATGAACAGGAACTGCGCTACTTCCGCGAGAGCTCCTCGGAGTTTG
CGCGCGCCTTTCCGAAGATCGCGCACCGCCTGGGCATCGAAGGCCAGGAGGTCGCCGATCCGTACGTCGA
GCGGCTGATCGAGGCCACGGCCTTCCTGTCGGCGCGCGTCAACCTGAAGCTCGATGCCGAGTACCCGCGC
TTCACGGGCCACCTGCTCGACATCGTCTATCCGAATTTCCTCGCGCCCACGCCGGCCATGGCGGTCGTCT
CGTTCTCGCCCGACCTGGACGACGCAAACCTTGCGACCGGTCCCAGGCTGCCGCGCGGCGCGGGCCTGCG
CGCGCGGCAGGCCGTGGGGCAGAACACGCACTGCGAGTTCCGCACCTCGAGCGCGCTGCGCATCTGGCCG
ATCGAGATCCAGCGCGCCCAGTACTTCACCTATGCGCCCGACCTGCCGCTCGCCACGCACCCCCAGTCCC
GCGCCATCCGCGGCGGCCTGCGCATCACGCTGCATGCGACGGCGGGGCTCAACTTCAGCCAGATTCAGCT
CGACGACCTGGTGCTGCACCTGGGCGGCGCCGAAGATGTGGCGTGGCAGCTGCAGGAGTGCGCGCTGGGC
CAGCCCATCGGCGTGATGGTGCGGCCGCTGTCGCCCACCGGTGCGCTGCAGGGCGCGGCGCAGAGCCTGC
CGGCCACGGCGATCCAGCCGGTCGGCTTCGAGGACGATGAAGCGCTGCTGCCGGTCACGGCCACCGGCTT
CTCGGGCTTTCGGCTGCTGCAGGAGTACTTCGCGTTTCCACAGCGCTTCCAGTTCCTGCGCATCGCCGGG
CTGCAGTCGGTGCTTGCGGCCATGCCGGTCGCCGAGGTCGAGCTCGTGCTGCTGTTCTCGCGCGGCGATG
CGGCGCTCGAAAAGCTGGTGAGCGCCGACAACGTGCAGCTGCACTGCGTGCCGGTGGTCAACCTGTTCAA
CAAGCGGCTCGACCGCGTGCCGCTGACCGAAGGCGTGAGCCAGTTCCACCTGGTGCCCGACCGCACGCGG
CCGCAGGATTTCGAGGTGCACACTGTCACCGAGGTCATCGGCCACGGCGCACCGGGCGCCGATGCAGCGG
CCGCCGAACAGGTGTTCCGCCCTTTCTATTCGGCCTTCCATGGCACGCGGCACAGCCACCCGGCCTACTT
CACGACCACGCGCGAGCCGCGGATGCTGTCGGTGCGCCAGCGCACCGAGGGCCATCGCAGCAGCCACATC
GGCTCCGAGGTCTACATGCAGATCGTCGATCCGCAGCAGGCGCCGTACGCCGCCACGCTGCGGCAGCTCG
CGGTGGCCGCGCTGTGCACCAACCGCGACCTGCCGCTCCTGATGCCGCTGGGACGCGACAACGACTTCGA
CTGCGTCGACTCCTTCCCCGTGCAGCGGGTGCGCATGGTGCGCGGTCCTTCGCGGCCGGTGTCGCCGGTG
GTGAGCCAGGGGCTGGGCTGGCGGGTGGTCGATCACCTGGCGCTCAACTACCTGTCGATCTCCGACAGCA
CGCCGGAGCAAGGCGCTGCCGCATTGCGCGAAACGCTGATGCTCTATGCCACGCATGCCGACGAGATGCG
CCAGGGCCAGGTGCGCGGCCTGCTCTCGGTGAAAGCCAAGCCCGTGGCGCGCCGCCTGCCGCTCAAGGGG
CCGATCGCTTTCGGGCGCGGGCTCGAAGTGACGCTCGAGGTCGACAAGGACGCATTCCACGGCCACAGCG
TGTTCCTGTTCGGCGCGGTGATGGCGCGCTTTCTGGCGCGCCATGTGGAGGTCAACCATTTCGTCGAGAC
CGTGCTGCGCGTGGCGGGCCGGGGCGAGACCATGCGATGGAGGCCGCTGTGCGGGACCCGGCAGATTCTG
TAG
 Primer design