SecReT6
Protein ID: 239813547
SecReT6 ID348
T6SS typei3
Gene symbol-
Locus tagVapar_0528
StrainVariovorax paradoxus S110
Repliconchromosome I [GenBank: NC_012791] [Browse all T6SS(s) in this replicon]
Location [Strand]582296..583375 [+]
Producttype VI secretion protein
NoteTssG
UniProt IDC5CK93
KEGG IDvap:Vapar_0528
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 5.80E-97, Aligned region: 21..329
Protein Sequence: 359 a.a.     [Download]
>gi|239813547|ref|YP_002942457.1| type VI secretion protein [Variovorax paradoxus S110]
MRDPADSVAGRVDTALRAWSAEPWSFDYFAVLRRLESVAATTPRWGRALLPSAEPVRVGQEPSLSFAPAS
FSRFEPASAHSPPRLRQHFFSYVGPNGPLPVHLSDFIRERSLNHGDPTWLAFLDSFLHRFSLHFYRAWAQ
ARPAVALDRPGEDRFRLQVGAFVGIGTPGRIERDEVHDDARLHFSGWLARRVHNAESVEAVLCSYFGVPV
KLERWVGHWMSLPAGELTRLGQGESSRSMGMGAMLGTRAWDRQHRVRLHIGPLTLAQYRMFLPTGNAQPV
LQRWMQQLLGDELEWDAELVLETTQVPATRLGQAKGNAPRLGWVSWLGQRTRAKDAADVRIGNRPMTARS
AQATVGAAA
 
Nucleotide Sequence: 1080 bp     [Download]
>gi|239813019|ref|NC_012791.1|:582296-583375 Variovorax paradoxus S110 chromosome 1, complete sequence
GTGCGGGACCCGGCAGATTCTGTAGCCGGGAGAGTCGACACCGCGCTGCGCGCATGGTCGGCCGAGCCGT
GGTCCTTCGACTATTTTGCGGTGCTGCGCCGGCTGGAGTCGGTGGCCGCGACCACGCCGCGCTGGGGCCG
TGCCCTGCTGCCGAGCGCGGAGCCGGTGCGCGTGGGACAGGAGCCGTCGCTGTCGTTCGCGCCGGCCAGC
TTCAGCCGCTTCGAGCCGGCCAGCGCCCACTCGCCGCCGCGCCTGCGCCAGCACTTCTTCAGCTATGTCG
GGCCCAACGGTCCGCTGCCGGTGCACCTGAGCGACTTCATCCGCGAGCGCAGCCTGAACCATGGCGACCC
GACCTGGCTGGCCTTTCTCGACAGCTTTCTGCACCGCTTCTCGCTGCACTTCTACCGCGCCTGGGCGCAG
GCGCGGCCCGCGGTGGCGCTCGACCGGCCGGGCGAGGACCGCTTCCGCCTGCAGGTTGGCGCGTTCGTGG
GCATCGGCACGCCGGGCCGCATCGAGCGCGACGAGGTGCACGACGATGCGCGCCTGCATTTCTCGGGCTG
GCTCGCGCGCCGCGTGCACAACGCCGAGAGCGTGGAAGCGGTGCTGTGCAGCTACTTCGGCGTGCCCGTG
AAGCTGGAGCGCTGGGTCGGCCACTGGATGAGCCTGCCCGCGGGCGAGCTCACGCGGCTGGGGCAGGGCG
AGAGTTCGCGTTCGATGGGCATGGGCGCGATGCTCGGCACGCGCGCGTGGGACCGGCAGCACCGCGTGCG
CCTGCACATCGGCCCGCTCACGCTCGCGCAGTACCGCATGTTCCTGCCGACCGGCAACGCGCAGCCGGTG
CTGCAGCGCTGGATGCAGCAGCTGCTCGGCGACGAACTCGAATGGGACGCCGAGCTGGTGCTCGAGACGA
CGCAGGTGCCCGCCACGCGCCTTGGCCAGGCCAAGGGCAACGCGCCGCGCCTGGGCTGGGTCTCGTGGCT
CGGCCAGCGCACGCGTGCCAAGGATGCGGCGGACGTGCGCATCGGCAACCGCCCGATGACCGCCCGCAGC
GCCCAGGCCACCGTGGGAGCCGCCGCATGA
 Primer design