SecReT6
Protein ID: 239813549
SecReT6 ID348
T6SS typei3
Gene symbol-
Locus tagVapar_0530
StrainVariovorax paradoxus S110
Repliconchromosome I [GenBank: NC_012791] [Browse all T6SS(s) in this replicon]
Location [Strand]584776..587505 [+]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDC5CK95
KEGG IDvap:Vapar_0530
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 3.30E-39, Aligned region: 233..312
AAA_2 [PF07724], Evalue: 3.30E-39, Aligned region: 641..807
AAA [PF00004], Evalue: 2.00E-20, Aligned region: 235..368
AAA [PF00004], Evalue: 2.00E-20, Aligned region: 647..731
ClpB_D2-small [PF10431], Evalue: 8.80E-15, Aligned region: 216..229
ClpB_D2-small [PF10431], Evalue: 8.80E-15, Aligned region: 814..892
AAA_5 [PF07728], Evalue: 2.00E-12, Aligned region: 235..259
AAA_5 [PF07728], Evalue: 2.00E-12, Aligned region: 646..763
AAA_16 [PF13191], Evalue: 4.10E-12, Aligned region: 35..71
AAA_16 [PF13191], Evalue: 4.10E-12, Aligned region: 213..257
AAA_16 [PF13191], Evalue: 4.10E-12, Aligned region: 279..314
AAA_16 [PF13191], Evalue: 4.10E-12, Aligned region: 638..691
AAA_22 [PF13401], Evalue: 8.90E-08, Aligned region: 235..316
AAA_22 [PF13401], Evalue: 8.90E-08, Aligned region: 644..673
Sigma54_activat [PF00158], Evalue: 1.40E-07, Aligned region: 219..261
Sigma54_activat [PF00158], Evalue: 1.40E-07, Aligned region: 646..765
AAA_14 [PF13173], Evalue: 1.30E-06, Aligned region: 235..325
AAA_14 [PF13173], Evalue: 1.30E-06, Aligned region: 645..743
NACHT [PF05729], Evalue: 1.80E-05, Aligned region: 235..321
NACHT [PF05729], Evalue: 1.80E-05, Aligned region: 647..673
AAA_17 [PF13207], Evalue: 1.80E-05, Aligned region: 235..276
AAA_17 [PF13207], Evalue: 1.80E-05, Aligned region: 646..682
AAA_19 [PF13245], Evalue: 2.60E-05, Aligned region: 234..258
AAA_19 [PF13245], Evalue: 2.60E-05, Aligned region: 644..668
Zeta_toxin [PF06414], Evalue: 2.70E-05, Aligned region: 234..258
Zeta_toxin [PF06414], Evalue: 2.70E-05, Aligned region: 638..696
AAA_18 [PF13238], Evalue: 9.30E-05, Aligned region: 235..259
AAA_18 [PF13238], Evalue: 9.30E-05, Aligned region: 648..675
IstB_IS21 [PF01695], Evalue: 0.00019, Aligned region: 219..257
IstB_IS21 [PF01695], Evalue: 0.00019, Aligned region: 646..667
Arch_ATPase [PF01637], Evalue: 0.00021, Aligned region: 213..256
Arch_ATPase [PF01637], Evalue: 0.00021, Aligned region: 286..318
Arch_ATPase [PF01637], Evalue: 0.00021, Aligned region: 645..667
AAA_25 [PF13481], Evalue: 0.00053, Aligned region: 217..259
AAA_25 [PF13481], Evalue: 0.00053, Aligned region: 288..327
AAA_25 [PF13481], Evalue: 0.00053, Aligned region: 644..671
AAA_29 [PF13555], Evalue: 0.00057, Aligned region: 227..251
AAA_29 [PF13555], Evalue: 0.00057, Aligned region: 643..671
DUF815 [PF05673], Evalue: 0.0016, Aligned region: 208..311
DUF815 [PF05673], Evalue: 0.0016, Aligned region: 645..687
NTPase_1 [PF03266], Evalue: 0.0042, Aligned region: 235..258
NTPase_1 [PF03266], Evalue: 0.0042, Aligned region: 286..312
NTPase_1 [PF03266], Evalue: 0.0042, Aligned region: 646..668
Clp_N [PF02861], Evalue: 0.0047, Aligned region: 28..70
Hpr_kinase_C [PF07475], Evalue: 0.0049, Aligned region: 235..247
Hpr_kinase_C [PF07475], Evalue: 0.0049, Aligned region: 644..664
UPF0079 [PF02367], Evalue: 0.0073, Aligned region: 235..256
UPF0079 [PF02367], Evalue: 0.0073, Aligned region: 643..674
RNA_helicase [PF00910], Evalue: 0.0076, Aligned region: 236..256
RNA_helicase [PF00910], Evalue: 0.0076, Aligned region: 647..668
SRP54 [PF00448], Evalue: 0.0077, Aligned region: 234..257
SRP54 [PF00448], Evalue: 0.0077, Aligned region: 645..679
TIP49 [PF06068], Evalue: 0.0095, Aligned region: 235..257
TIP49 [PF06068], Evalue: 0.0095, Aligned region: 283..315
TIP49 [PF06068], Evalue: 0.0095, Aligned region: 645..682
Protein Sequence: 909 a.a.     [Download]
>gi|239813549|ref|YP_002942459.1| type VI secretion ATPase, ClpV1 family [Variovorax paradoxus S110]
MSEISRTALFGKLNSLAYKAIEGATVFCKMRGNPYVELEHWFAQLLQAQDSDLHRVIQHYGLDVSVIAKD
MTAALDRLPRGATAISDFSPHIENAIERAWTYATLQFGEAQVRTGYILVGMLKTQSLRNPLFGLSKQFEK
VKVEDLADNFAKICDASPESQMRAQDGTGMGSGAPGEDSGAMAPAAMGKGDALKKFAVDLTEKAKKGEMD
PITGRDEEIRQIVDILMRRRQNNPLLTGEAGVGKTAVVEGFAQRLARGDVPPQLKDVKLLTLDIGLLQAG
ASMKGEFEQRLRQVIDEVQASPTPIILFIDEIHTLVGAGGAAGTGDAANLLKPALARGNLRTIGATTWAE
YKKYIEKDPALTRRFQVVQVPEPDEVKAILMLRGVASVLEKHHRVQLLDEAIEAAVKLSHRYIPARQLPD
KAVSLLDTACARVAVSQHATPPEVEDCMRRIEGLTVEQEIIGREEAIGIDVTKRAAQVSALLLESNGQLE
TLSARWKEEKGLVDRLLELRSKLRAGSKPVDTASAEGDAKADVPPPQPSPGGGGSEDRAALLEELHALQA
KIHAVQGESPLILPSVDEQAVASVVADWTGIPVGRMVKNEVEAVLKLADTLNQRVIGQKHGLEMIARRIQ
TSRARLDNPQKPIGVFMLCGTSGVGKTETALALAEALYGGEQNIITINMSEFQEAHTVSTLKGAPPGYVG
YGEGGILTEAVRRRPYSVVLLDEVEKAHPDVHEIFFQVFDKGWMEDGEGRMIDFKNTIILLTTNAGSELV
MSMCRDPELLPDSNALADALKAPLMKVFPPALLGRIVTIPYYPLSPDMMKKIVRLQLGRIKKRVETNHGV
PFEYSDAVVDQVVARCQDPESGGRVIDAILTNTVLPTISVEYLQRLASGGEIRRVALDVKDADFTYAFD
 
Nucleotide Sequence: 2730 bp     [Download]
>gi|239813019|ref|NC_012791.1|:584776-587505 Variovorax paradoxus S110 chromosome 1, complete sequence
ATGAGTGAAATCAGTCGCACCGCCCTTTTCGGCAAACTCAACTCGCTGGCCTACAAGGCCATCGAGGGCG
CCACGGTGTTCTGCAAGATGCGGGGCAATCCGTATGTGGAACTGGAGCACTGGTTCGCCCAGCTGCTGCA
GGCGCAGGACTCCGACCTGCACCGCGTGATCCAGCACTACGGCCTCGACGTGTCGGTCATCGCCAAGGAC
ATGACGGCCGCGCTCGACCGCCTGCCGCGCGGCGCCACCGCCATCAGCGATTTTTCCCCGCACATCGAGA
ACGCCATCGAGCGCGCCTGGACCTACGCCACCCTGCAGTTCGGCGAAGCGCAGGTGCGCACCGGCTACAT
CCTGGTGGGCATGCTCAAGACGCAGAGCCTGCGCAACCCGCTGTTCGGTTTGTCGAAGCAGTTCGAGAAG
GTCAAGGTCGAGGACCTGGCCGACAACTTCGCGAAGATCTGCGACGCCTCGCCCGAATCGCAGATGCGCG
CGCAGGACGGCACCGGCATGGGCAGCGGCGCGCCCGGCGAAGACTCGGGCGCGATGGCGCCCGCCGCCAT
GGGCAAGGGCGACGCGCTCAAGAAGTTCGCGGTCGACCTCACCGAGAAGGCCAAGAAGGGCGAGATGGAC
CCGATCACCGGACGCGACGAGGAGATCCGCCAGATCGTCGACATCCTGATGCGCCGCCGCCAGAACAACC
CGCTGCTCACGGGCGAGGCGGGCGTTGGCAAGACCGCGGTGGTCGAAGGCTTCGCGCAGCGCCTCGCGCG
CGGCGACGTGCCGCCGCAGCTCAAGGACGTGAAGCTGCTCACGCTCGACATCGGCCTCTTGCAGGCCGGC
GCCAGCATGAAGGGCGAGTTCGAGCAGCGGCTGCGCCAGGTGATCGACGAGGTGCAGGCATCGCCCACGC
CCATCATTCTTTTCATCGACGAGATCCACACGCTGGTGGGCGCGGGCGGCGCGGCCGGCACCGGCGATGC
GGCCAACCTGCTGAAGCCCGCATTGGCGCGCGGCAACCTGCGCACCATCGGCGCCACCACCTGGGCCGAG
TACAAGAAGTACATCGAGAAAGACCCGGCGCTGACGCGGCGCTTCCAGGTGGTGCAGGTGCCCGAGCCCG
ACGAGGTGAAGGCCATCTTGATGCTGCGCGGCGTGGCCAGCGTGCTCGAGAAGCACCACCGCGTGCAGCT
GCTCGACGAGGCCATCGAGGCGGCCGTGAAGCTGAGCCACCGCTACATTCCCGCGCGCCAATTGCCCGAC
AAGGCCGTGAGCCTGCTCGACACGGCATGCGCGCGCGTGGCTGTGAGTCAGCACGCGACGCCGCCTGAAG
TTGAAGACTGCATGCGCCGCATCGAGGGACTCACGGTCGAGCAGGAGATCATCGGCCGCGAGGAAGCCAT
CGGCATCGACGTGACCAAGCGCGCGGCGCAGGTCTCCGCGCTGCTGCTGGAATCGAACGGGCAGCTGGAA
ACGCTCAGCGCCCGCTGGAAGGAAGAGAAGGGGCTGGTCGATCGGTTGCTGGAATTGCGCAGCAAATTGC
GTGCGGGGAGCAAGCCGGTGGACACTGCTTCCGCCGAGGGCGATGCGAAAGCCGACGTGCCCCCACCCCA
GCCCTCCCCCGGCGGGGGAGGGAGCGAAGACCGGGCTGCGCTGCTTGAAGAACTGCATGCGCTGCAGGCC
AAGATCCATGCGGTGCAAGGCGAGTCGCCACTGATCCTGCCTTCGGTCGATGAGCAGGCCGTGGCCTCGG
TGGTGGCCGACTGGACCGGCATTCCCGTCGGCCGCATGGTCAAGAACGAAGTGGAGGCGGTGCTCAAGCT
CGCCGACACGCTCAACCAGCGCGTCATCGGCCAGAAGCACGGCCTGGAGATGATCGCGCGGCGCATCCAG
ACGTCTCGCGCGCGGCTGGACAACCCGCAAAAGCCGATCGGCGTCTTCATGCTCTGCGGCACCTCGGGCG
TGGGCAAGACCGAGACCGCACTGGCACTGGCCGAGGCGCTGTACGGCGGCGAGCAGAACATCATCACCAT
CAACATGAGCGAGTTCCAGGAGGCGCACACGGTCTCCACGCTCAAGGGCGCGCCGCCCGGCTACGTGGGC
TACGGCGAGGGCGGCATCCTGACCGAGGCGGTGCGCCGCCGGCCCTACAGCGTGGTGCTGCTCGACGAGG
TCGAGAAGGCCCACCCCGACGTGCACGAGATCTTCTTCCAGGTGTTCGACAAGGGCTGGATGGAAGACGG
CGAGGGCCGCATGATCGATTTCAAGAACACGATCATCCTGCTCACCACCAACGCCGGCAGCGAGCTGGTG
ATGAGCATGTGCCGCGACCCCGAGCTGCTGCCCGATTCCAACGCGCTGGCCGATGCGCTGAAAGCGCCGC
TCATGAAGGTGTTCCCGCCCGCGCTCCTGGGCCGCATCGTCACCATTCCCTACTACCCGCTGTCGCCGGA
CATGATGAAGAAGATCGTGCGGCTGCAGCTGGGCCGCATCAAGAAGCGCGTGGAGACCAACCACGGCGTG
CCCTTCGAGTACAGCGACGCGGTGGTCGACCAGGTGGTTGCGCGCTGCCAGGACCCGGAGTCGGGCGGGC
GCGTGATCGACGCGATCCTGACCAACACGGTGCTGCCAACGATTTCTGTCGAGTACCTGCAGCGGCTGGC
CTCGGGCGGCGAGATCCGCCGCGTCGCGCTCGATGTGAAGGACGCCGACTTCACCTACGCGTTCGACTGA
 Primer design