SecReT6
Protein ID: 239813550
SecReT6 ID348
T6SS typei3
Gene symbol-
Locus tagVapar_0531
StrainVariovorax paradoxus S110
Repliconchromosome I [GenBank: NC_012791] [Browse all T6SS(s) in this replicon]
Location [Strand]587530..590541 [+]
Producttype VI secretion system Vgr family protein
NoteTssI
UniProt IDC5CK96
KEGG IDvap:Vapar_0531
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.00E-57, Aligned region: 27..335
Phage_base_V [PF04717], Evalue: 1.60E-25, Aligned region: 416..509
Protein Sequence: 1003 a.a.     [Download]
>gi|239813550|ref|YP_002942460.1| type VI secretion system Vgr family protein [Variovorax paradoxus S110]
MADHEFRIETDSPAKDDLMFWRIVGHEALARPSAYELTVLSKNKALDAKDILGRAFDVVIQFQDKDGGVH
ERHCQGHAVRFVRAGHVGRHFEYRVTLRSWFWLLTKRTNSRILQDKKVLEVLDAVFEDSPIKRFKKTKAG
NVIGTHTPRRYCVQHQENDYQFLSRLLEDEGIYYWFDAHDAPGTMHLSDASDLAHEKLPVEGTLRYMSSD
ASEARHNEISRWVSARQFDTGKQASRDSDFKAIKKKLAATIDVKDDHELADFEEFEFPGGYFTGDDGENR
TKLRGDELNARRDRHWALTTWPDVAAGRSFKFEGDPDGTRNGDYVIAACTFMASHPGYESVGAGTAVPQD
LRTALAGVLRDDAVNADTLQVLEDLIASTPMLSTSQPGTSAFLITAIPMERAYRPPRLTPRVTMPGPQTA
IVVGPAGDELHVDEHGRVKVHFHWDRYDESNEKSTCWVRVSQPWSGKGWGGYFIPRIGQEVIVDFINGDP
DRPIVVGRVYNDDQPIPYKSPTQSGFKTRSTPGGGPANYNEIMFEDKKGEENINIHAERNMSRSVERDDS
TTVGRDQSLVVERDQSGIVQRDQSLAVTRNRSIHVKNNESHIVDVNQSLKVIGNQENKIVGNQVTTVDGV
HQVEAKGDIRTKTSGNRIDHTTGNETRKVSGNQTFTVSGNMGFKAATIVMETPHFEWKITGANSAVMAVP
SGPYSIMANKFSVLSNTDASILAVGKINQTSIENNVTVMGNNNSGYVGMASETNMGLARSTFLGVAIDTF
MGASISNTLALQFEAVAAAKLSIAVGPHIEMNSMKMYVPGGGAAGGGATVLSEGAEFLAIVGVLEGVNVG
FMSSVIGFAELSDQYSDAKAELAQAARDAAAAGHPGLAARLNRLATDGAGTMDKDAPTSTQNTRGDAFSS
DYDPFAVPDGGSSSDPSAGGDGPTSSEPSSSEPSSSGPSSSEPTSSEPSSSEPSSSEPSSSEPSSSEPSS
SGPSSSGPSSSEPNSSEPNSSGF
 
Nucleotide Sequence: 3012 bp     [Download]
>gi|239813019|ref|NC_012791.1|:587530-590541 Variovorax paradoxus S110 chromosome 1, complete sequence
ATGGCCGATCACGAGTTCCGCATCGAGACAGATTCACCCGCCAAGGACGACCTGATGTTCTGGCGCATCG
TGGGCCACGAGGCGCTGGCGCGCCCGTCGGCCTACGAGCTCACGGTGCTGTCGAAGAACAAGGCGCTCGA
TGCCAAGGACATTCTCGGCCGCGCTTTCGACGTGGTCATCCAGTTCCAGGACAAGGACGGCGGCGTGCAC
GAGCGCCACTGCCAGGGCCACGCCGTGCGCTTCGTGCGGGCCGGGCATGTGGGCAGGCATTTCGAATACC
GCGTCACGCTGCGCTCGTGGTTCTGGCTGCTCACCAAGCGCACCAACTCGCGCATCCTGCAGGACAAGAA
GGTGCTCGAGGTGCTCGACGCGGTCTTCGAAGACAGCCCGATCAAGCGCTTCAAGAAGACCAAGGCCGGC
AACGTCATCGGCACCCACACGCCCCGGCGCTACTGCGTGCAGCACCAGGAGAACGACTACCAGTTCCTCT
CGCGCCTGCTGGAGGACGAAGGCATCTACTACTGGTTCGACGCGCACGACGCGCCCGGCACCATGCACCT
GTCGGACGCGAGCGACCTGGCGCACGAGAAGCTGCCGGTGGAAGGCACGCTGCGCTACATGTCCAGCGAC
GCGAGCGAGGCGCGCCACAACGAGATCTCGCGCTGGGTGAGCGCACGCCAGTTCGACACCGGCAAGCAGG
CCTCGCGCGACAGCGACTTCAAGGCGATCAAGAAGAAGCTGGCTGCCACCATCGATGTGAAGGACGACCA
CGAACTCGCCGACTTCGAGGAGTTCGAATTCCCGGGCGGCTACTTCACGGGCGACGACGGCGAGAACCGC
ACCAAGCTGCGCGGCGACGAGCTCAACGCGCGCCGCGACCGCCACTGGGCGCTGACCACCTGGCCCGACG
TGGCCGCGGGGCGCAGCTTCAAGTTCGAGGGCGACCCCGACGGCACACGCAACGGCGACTACGTGATCGC
GGCCTGCACCTTCATGGCAAGCCACCCTGGCTATGAAAGCGTGGGCGCCGGCACGGCCGTTCCACAGGAC
CTGCGCACGGCGCTGGCCGGCGTGCTGCGCGACGATGCGGTGAACGCCGACACGCTGCAGGTGCTGGAAG
ACCTGATCGCCAGCACGCCGATGCTCAGCACCTCGCAGCCGGGCACCAGCGCATTCCTGATCACCGCGAT
ACCGATGGAGCGGGCCTACCGGCCGCCGCGCCTCACGCCGCGCGTGACCATGCCCGGTCCGCAGACGGCC
ATCGTGGTCGGCCCCGCGGGCGACGAGCTGCACGTGGACGAGCACGGCCGCGTGAAGGTGCACTTCCACT
GGGACCGCTACGACGAGAGCAACGAGAAGTCGACCTGCTGGGTGCGCGTGTCGCAGCCCTGGAGCGGCAA
GGGCTGGGGCGGGTACTTCATTCCGCGCATCGGCCAGGAGGTGATCGTCGATTTCATCAACGGCGACCCC
GACCGGCCGATCGTCGTGGGCCGCGTCTACAACGACGACCAGCCCATTCCCTACAAGTCGCCCACGCAGA
GCGGCTTCAAGACCCGCTCCACGCCCGGCGGCGGTCCCGCGAACTACAACGAGATCATGTTCGAGGACAA
GAAGGGCGAGGAGAACATCAACATCCATGCGGAGCGCAACATGAGCCGCAGCGTGGAGCGCGACGATTCC
ACCACCGTGGGCCGCGACCAGAGCCTGGTGGTCGAGCGCGACCAGAGCGGCATCGTCCAGCGTGACCAGA
GCCTGGCCGTCACGCGCAACCGCAGCATCCACGTCAAGAACAACGAGTCGCACATCGTCGACGTCAACCA
GAGCCTGAAGGTCATCGGCAACCAGGAAAACAAGATCGTCGGCAACCAGGTCACCACGGTGGACGGCGTG
CACCAGGTCGAGGCCAAGGGCGACATCCGCACCAAGACCTCGGGCAACCGCATCGACCACACCACAGGCA
ATGAAACGCGCAAGGTAAGCGGCAACCAGACCTTCACCGTCTCCGGAAACATGGGCTTCAAGGCGGCCAC
CATCGTGATGGAAACGCCGCACTTCGAATGGAAGATCACCGGTGCCAATTCCGCGGTGATGGCGGTGCCC
AGCGGCCCCTACTCGATCATGGCGAACAAGTTCAGCGTGCTGAGCAACACGGACGCCTCGATCCTGGCGG
TCGGCAAGATCAACCAGACGTCGATCGAGAACAACGTCACGGTCATGGGGAACAACAACAGCGGCTACGT
CGGCATGGCGAGCGAGACGAACATGGGGCTGGCCCGCAGCACCTTTCTCGGCGTGGCCATCGACACCTTC
ATGGGTGCGAGCATCAGCAACACGCTGGCGCTGCAGTTCGAGGCGGTGGCCGCCGCCAAGCTGAGCATCG
CGGTGGGGCCGCACATCGAGATGAATTCGATGAAGATGTACGTGCCCGGTGGAGGGGCCGCCGGCGGCGG
CGCCACGGTGCTGAGCGAGGGCGCGGAGTTCCTGGCGATCGTCGGCGTGCTGGAAGGGGTGAACGTGGGC
TTCATGTCCTCCGTCATCGGGTTCGCCGAGCTGTCGGACCAGTACAGCGATGCCAAGGCGGAACTGGCGC
AGGCGGCCCGGGATGCCGCCGCTGCCGGGCACCCGGGCCTGGCCGCGCGCCTGAACCGCCTGGCCACCGA
CGGCGCGGGCACCATGGACAAGGACGCGCCGACGAGCACCCAGAACACCCGGGGCGACGCCTTCTCATCG
GACTACGACCCCTTTGCCGTGCCCGACGGCGGATCTTCCAGCGATCCATCCGCCGGCGGCGACGGGCCGA
CCTCGTCGGAGCCCAGCTCGTCAGAGCCCAGTTCATCCGGGCCCAGCTCGTCCGAGCCCACTTCGTCGGA
GCCCAGCTCGTCAGAGCCCAGTTCGTCCGAGCCCAGTTCGTCCGAGCCCAGTTCGTCCGAGCCCAGTTCA
TCCGGGCCCAGCTCATCCGGGCCCAGCTCATCAGAGCCCAATTCGTCCGAACCCAATTCCTCCGGTTTCT
GA
 Primer design