SecReT6
Protein ID: 239813563
SecReT6 ID348
T6SS typei3
Gene symbol-
Locus tagVapar_0544
StrainVariovorax paradoxus S110
Repliconchromosome I [GenBank: NC_012791] [Browse all T6SS(s) in this replicon]
Location [Strand]604203..605867 [+]
ProductFHA domain containing protein
NoteFha
UniProt IDC5CKA9
KEGG IDvap:Vapar_0544
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 5.90E-12, Aligned region: 28..93
Protein Sequence: 554 a.a.     [Download]
>gi|239813563|ref|YP_002942473.1| FHA domain containing protein [Variovorax paradoxus S110]
MIHIAVITRQGAPAGQPIAADFGPNGGTIGRADTNTLVLDDPDRTVSRVHAQVLCRDGQYFVIDRGSNPM
QCNGVSLGSGKEAPLADGARLIVGSFELSVRMSAAAPPALAIPNTVMSAPLGAAPAASTSDDPFADLLAG
LGSPAPAAARASGARAAAPASADPLLFPDPMESGSRNAQAAQVDPFANLLGPTPSAAPAAGFGALDDFSD
LGAPPAHGKAAGIDELFGGMGGGGGIGGDPLALSPLADPLLQPNTASSADPLAALQSAAPPTPTPRSDHL
PIDQFGFTPPKAITPVPAAAPVEALPRFDDITGQPIRISGPEVASRPFEPLPPPPPPAPAPAPAPVQRAP
AAAPRTASDDELLAAFLRGLASTHQPPEMLTPGLMERIGSILRSATEGTLQLLLTRQEFKREVRAEVTMI
AAQANNPLKFSPTVEVALAHLLGPGVRGFMPPEAAMRDAFNDLRAHQFGVMVGMRAALAHVIARFEPEEL
EKKISAKSALDTLFSANRKAKLWDQFVALYGGIASEAEDDFHSLFGKAFLEAYEEQMARLKSDT
 
Nucleotide Sequence: 1665 bp     [Download]
>gi|239813019|ref|NC_012791.1|:604203-605867 Variovorax paradoxus S110 chromosome 1, complete sequence
ATGATCCATATCGCTGTCATCACCCGGCAAGGCGCTCCGGCGGGGCAGCCCATCGCTGCCGATTTCGGGC
CCAACGGGGGCACCATCGGGCGCGCCGACACCAACACGCTGGTGCTCGACGATCCGGACCGCACGGTTTC
GCGCGTGCACGCGCAGGTGCTGTGCCGCGACGGCCAGTACTTCGTCATCGACCGCGGCAGCAATCCGATG
CAGTGCAACGGCGTGTCGCTGGGCTCGGGCAAGGAGGCTCCGCTCGCGGATGGCGCGCGGCTGATCGTGG
GCAGCTTCGAACTCAGCGTGCGCATGAGCGCGGCCGCGCCGCCGGCATTGGCCATTCCCAACACCGTGAT
GTCGGCGCCGCTCGGCGCCGCCCCCGCGGCCAGCACCAGCGACGATCCCTTTGCCGACCTGCTTGCGGGG
CTCGGATCGCCCGCGCCTGCCGCGGCCCGTGCATCCGGTGCCAGGGCGGCCGCGCCGGCAAGCGCGGATC
CGCTGCTCTTTCCCGACCCGATGGAAAGCGGCTCGCGCAACGCGCAGGCCGCGCAGGTCGATCCCTTCGC
CAACCTGCTCGGGCCCACGCCGTCCGCTGCGCCGGCCGCAGGCTTCGGTGCGCTCGACGATTTCTCCGAC
CTCGGCGCGCCGCCCGCGCACGGCAAGGCCGCCGGCATCGACGAGCTCTTCGGCGGCATGGGCGGTGGCG
GCGGCATCGGCGGCGATCCGCTCGCGCTGTCGCCGCTGGCCGACCCGCTGCTGCAGCCGAACACGGCTTC
GTCCGCCGATCCGCTGGCCGCATTGCAGAGCGCGGCGCCGCCCACGCCGACACCGCGCTCCGATCACCTG
CCGATCGACCAGTTCGGCTTCACGCCGCCGAAGGCGATCACGCCGGTTCCGGCCGCCGCGCCGGTGGAAG
CGCTGCCGCGCTTCGACGACATCACAGGGCAGCCGATACGCATCAGCGGCCCTGAGGTCGCGAGCCGGCC
GTTCGAGCCGCTGCCGCCACCACCACCACCGGCGCCAGCGCCAGCGCCAGCGCCCGTCCAGCGGGCGCCC
GCCGCAGCCCCGCGCACCGCATCCGACGACGAACTGCTCGCCGCCTTCCTGCGTGGCCTCGCCAGCACGC
ACCAGCCGCCCGAGATGCTCACGCCCGGCCTCATGGAGCGCATCGGCTCGATCCTGCGCAGCGCCACCGA
AGGCACGCTGCAACTCCTGCTCACGCGCCAGGAGTTCAAGCGCGAGGTGCGCGCCGAGGTCACGATGATC
GCGGCGCAGGCCAACAACCCGCTCAAGTTCTCGCCCACCGTGGAGGTCGCGCTGGCCCACCTGCTGGGCC
CGGGCGTGCGCGGCTTCATGCCGCCCGAGGCCGCGATGCGCGATGCCTTCAACGACCTGCGCGCGCACCA
GTTCGGCGTGATGGTGGGCATGCGCGCGGCGCTGGCCCATGTCATTGCGCGCTTCGAGCCTGAAGAGCTC
GAGAAGAAGATCAGCGCGAAGTCGGCGCTCGACACGCTCTTCAGCGCCAACCGCAAGGCCAAGCTCTGGG
ACCAGTTCGTCGCGCTCTACGGCGGCATCGCGAGCGAGGCGGAAGACGACTTCCACAGCCTCTTCGGCAA
GGCCTTCCTCGAAGCCTATGAAGAGCAGATGGCGCGCCTCAAGTCGGACACCTGA
 Primer design