SecReT6
Protein ID: 239813567
SecReT6 ID348
T6SS typei3
Gene symbol-
Locus tagVapar_0548
StrainVariovorax paradoxus S110
Repliconchromosome I [GenBank: NC_012791] [Browse all T6SS(s) in this replicon]
Location [Strand]607989..608471 [-]
Producthypothetical protein
NoteTssD
UniProt IDC5CKB3
KEGG IDvap:Vapar_0548
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 3.20E-41, Aligned region: 6..136
Protein Sequence: 160 a.a.     [Download]
>gi|239813567|ref|YP_002942477.1| hypothetical protein Vapar_0548 [Variovorax paradoxus S110]
MAADMFLKLEGVDGESKDDSHKKEIDVLSWSWGASQSGTGHVGGGSGAGKVSVQDLSVTKYVDSSSHLLL
LDCCNGQHIKKGTLVVRKAGATPLEYIKLTMEDIIVSNIHTGGSGGEDRLTETITLNFSKFKYEYTPQKA
DGSGDGTKETGWDIAANKKV
 
Nucleotide Sequence: 483 bp     [Download]
>gi|239813019|ref|NC_012791.1|:c608471-607989 Variovorax paradoxus S110 chromosome 1, complete sequence
ATGGCTGCAGACATGTTTTTGAAGCTCGAGGGCGTCGACGGTGAATCCAAGGACGATTCGCACAAGAAGG
AGATCGACGTTCTCTCCTGGAGCTGGGGTGCCAGCCAATCGGGCACCGGCCACGTGGGCGGCGGCTCGGG
CGCAGGCAAGGTGAGCGTGCAAGACCTCTCGGTCACCAAGTACGTGGACTCCTCCTCGCACCTGCTGCTG
CTCGACTGCTGCAATGGCCAGCACATCAAGAAGGGCACGCTGGTGGTCCGCAAGGCCGGGGCCACGCCGC
TCGAGTACATCAAGCTCACGATGGAAGACATCATCGTCAGCAACATCCACACCGGCGGCAGCGGCGGCGA
AGACCGCCTGACCGAGACCATCACGCTGAACTTCTCGAAGTTCAAGTACGAGTACACGCCGCAGAAGGCC
GACGGTTCCGGCGACGGCACCAAGGAAACCGGCTGGGACATCGCCGCCAACAAGAAGGTCTGA
 Primer design