SecReT6
Protein ID: 239813568
SecReT6 ID348
T6SS typei3
Gene symbol-
Locus tagVapar_0549
StrainVariovorax paradoxus S110
Repliconchromosome I [GenBank: NC_012791] [Browse all T6SS(s) in this replicon]
Location [Strand]608618..610111 [-]
ProductEvpB family type VI secretion protein
NoteTssC
UniProt IDC5CKB4
KEGG IDvap:Vapar_0549
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.60E-192, Aligned region: 65..491
Protein Sequence: 497 a.a.     [Download]
>gi|239813568|ref|YP_002942478.1| EvpB family type VI secretion protein [Variovorax paradoxus S110]
MAEALEQSALKDVAYAGSDFSSLLQKEFKPRSDEAKSAVEAAVLTLAQQALSNSTVIGKDVTKSIQSMIA
AIDAKLTDQVNKIIHHPDYQKLESAWRGLHYMVNNTETDEHLKIRVMDISKTDLAKSLKKFKGAAWDQSP
MFKKIYEQEYGQFGGEPFGALVGDYHFDQSPPDIELLGEMSKIAASAHAPFITGASPNLMQMESWQELAN
PRDLTKIFLTPEYAGWRSLRDSDDAKYLGLCMPRFLARTPYGANTNPVEEFDFEEDTVGADHSKYAWANA
AYAMATNINRSYKLYGWGSRIRGIESGGAVENLPLHTFPSDDGGVDQKCPTEIAISDRREAELSKAGLLS
LIHRKNSDFAAFIGAQSLHKPAEYDDPDATANANLAARLPYLFACNRFAHYLKCIVRDKVGSFKERDDMQ
RWLNKWIMNYVDGDPVNSSEETKARKPLAAAEVVVEEVEGNPGYYTSKFFLRPHYQLEGLTVSLRLVSKL
PSAKGGK
 
Nucleotide Sequence: 1494 bp     [Download]
>gi|239813019|ref|NC_012791.1|:c610111-608618 Variovorax paradoxus S110 chromosome 1, complete sequence
ATGGCCGAAGCACTCGAGCAGAGCGCACTCAAGGATGTCGCCTATGCGGGCAGCGATTTTTCGTCGCTCC
TGCAAAAGGAATTCAAGCCGCGCAGCGACGAAGCCAAGAGCGCCGTCGAAGCCGCGGTGCTCACGCTCGC
GCAGCAGGCGCTGAGCAACAGTACCGTCATCGGCAAGGACGTGACCAAGTCGATCCAGTCGATGATCGCC
GCGATCGACGCCAAGCTGACCGACCAGGTCAACAAGATCATCCACCACCCCGACTACCAGAAGCTCGAGA
GTGCGTGGCGCGGCCTGCACTACATGGTGAACAACACCGAGACCGACGAGCACCTGAAGATCCGGGTGAT
GGACATCTCGAAGACGGACCTTGCCAAGAGCCTGAAGAAGTTCAAGGGCGCGGCCTGGGACCAGAGCCCG
ATGTTCAAGAAGATCTACGAGCAGGAATACGGCCAGTTCGGCGGCGAGCCCTTCGGCGCGCTGGTGGGCG
ACTACCACTTCGACCAGAGCCCGCCCGACATCGAGCTGCTGGGCGAGATGTCCAAGATCGCCGCCTCGGC
GCATGCGCCCTTCATCACCGGCGCGAGCCCCAACCTGATGCAGATGGAATCGTGGCAGGAGCTCGCCAAC
CCGCGCGACCTGACCAAGATCTTTCTCACGCCCGAGTACGCCGGCTGGCGGTCGCTGCGCGACTCCGACG
ACGCCAAGTACCTGGGCCTGTGCATGCCGCGCTTCCTGGCGCGCACGCCCTACGGCGCCAACACCAATCC
GGTGGAGGAGTTCGACTTCGAGGAAGACACCGTCGGCGCCGACCACAGCAAGTACGCCTGGGCCAACGCA
GCCTATGCGATGGCCACCAACATCAACCGCTCCTACAAGCTCTACGGCTGGGGTTCGCGCATCCGCGGCA
TCGAATCGGGCGGCGCGGTGGAGAACCTGCCGCTGCACACCTTCCCGAGCGACGACGGCGGCGTGGACCA
GAAGTGCCCGACCGAGATCGCCATCAGCGACCGGCGCGAAGCCGAGCTCTCGAAGGCCGGCCTGCTTTCG
CTGATCCACCGCAAGAACTCCGACTTCGCGGCCTTCATCGGTGCGCAGTCGCTGCACAAGCCGGCCGAGT
ACGACGACCCGGACGCCACGGCCAACGCCAACCTGGCGGCGCGCCTGCCCTACCTCTTTGCCTGCAACCG
CTTTGCGCACTACCTGAAGTGCATCGTGCGCGACAAGGTCGGCAGCTTCAAGGAGCGCGACGACATGCAG
CGCTGGCTCAACAAGTGGATCATGAACTACGTGGACGGCGACCCCGTCAACTCCTCCGAAGAGACCAAGG
CCAGGAAGCCCCTGGCCGCGGCCGAGGTGGTGGTGGAAGAGGTCGAGGGCAACCCCGGCTACTACACCTC
CAAGTTCTTCCTGCGCCCGCACTACCAGCTCGAAGGCCTCACGGTGTCGCTGCGGCTGGTGTCGAAGCTG
CCCTCGGCCAAGGGCGGCAAGTAG
 Primer design