SecReT6
Protein ID: 239813569
SecReT6 ID348
T6SS typei3
Gene symbol-
Locus tagVapar_0550
StrainVariovorax paradoxus S110
Repliconchromosome I [GenBank: NC_012791] [Browse all T6SS(s) in this replicon]
Location [Strand]610153..610671 [-]
Producttype VI secretion protein
NoteTssB
UniProt IDC5CKB5
KEGG IDvap:Vapar_0550
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 8.50E-60, Aligned region: 9..162
Protein Sequence: 172 a.a.     [Download]
>gi|239813569|ref|YP_002942479.1| type VI secretion protein [Variovorax paradoxus S110]
MAKSSQKFIARNRAPRVQIEYDVELYGAEKKIQLPFVMGVLADLSGKPADPLAPVADRKFLEFDVDNFDS
RMKAMKPRAAFAVENSLTGEGELKVELTFENMEDFSPAAVARKVGALDKLLEARTQLSNLVTYMDGKNGA
EELLAKVLEDPALLQSLAATAKPDDEAAKPAA
 
Nucleotide Sequence: 519 bp     [Download]
>gi|239813019|ref|NC_012791.1|:c610671-610153 Variovorax paradoxus S110 chromosome 1, complete sequence
ATGGCCAAGAGCAGTCAGAAATTCATCGCCCGCAACCGGGCGCCACGCGTGCAGATCGAGTACGACGTGG
AACTCTACGGCGCCGAGAAGAAGATCCAGCTGCCCTTCGTGATGGGCGTGCTGGCCGACCTGTCGGGCAA
GCCGGCCGATCCGCTCGCGCCCGTGGCCGACCGCAAGTTCCTCGAGTTCGACGTGGACAACTTCGACTCG
CGCATGAAGGCCATGAAGCCGCGCGCCGCCTTCGCGGTGGAGAACTCGCTGACCGGCGAAGGCGAGCTCA
AGGTCGAGCTCACCTTCGAGAACATGGAAGACTTCTCGCCCGCCGCCGTGGCCAGGAAGGTCGGCGCGCT
CGACAAGCTGCTCGAGGCGCGCACCCAGCTGTCGAACCTCGTGACCTACATGGACGGCAAGAACGGCGCC
GAGGAACTGCTGGCCAAGGTGCTCGAGGACCCGGCCCTGCTGCAGTCGCTGGCGGCCACCGCCAAGCCCG
ACGACGAAGCGGCCAAGCCGGCCGCCTGA
 Primer design