SecReT6
Protein ID: 239813570
SecReT6 ID348
T6SS typei3
Gene symbol-
Locus tagVapar_0551
StrainVariovorax paradoxus S110
Repliconchromosome I [GenBank: NC_012791] [Browse all T6SS(s) in this replicon]
Location [Strand]610742..611773 [-]
ProductImpA family type VI secretion-associated protein
NoteTssA
UniProt IDC5CKB6
KEGG IDvap:Vapar_0551
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 5.60E-22, Aligned region: 57..116
Protein Sequence: 343 a.a.     [Download]
>gi|239813570|ref|YP_002942480.1| ImpA family type VI secretion-associated protein [Variovorax paradoxus S110]
MLTTELVEALLTPIGEASPCGDDLEYDAAFTALTTAAQGKPEQQFGDTVIPAVEPEWREVAEQSDAILRR
SKDVRAAVLLLRASTRLQGLAGFVAGLELLTRLLDNFWDGIHPKLDAEDDNDPTMRLNALAPLGDETMVL
RDLYDAQVGVAPGVGAIRVRDIAVANNALNAVGGEATYSPAQIQGGLEALHAERPELIQAAIGVPGGVEK
LQALLVERTGRSDAIDLSPLRAIGRMLQKACSAAIGAPEEAGTAEEAQGDAPQAGGAPRPAAMRGEIQSR
QDALQMLDRVIRFLEQTEPGNPAPLLIERAKKLIGVSFLEIMANLAPGALDTIETVTGKRPSE
 
Nucleotide Sequence: 1032 bp     [Download]
>gi|239813019|ref|NC_012791.1|:c611773-610742 Variovorax paradoxus S110 chromosome 1, complete sequence
ATGCTGACCACCGAACTTGTCGAAGCCCTGCTCACGCCCATCGGCGAGGCCTCGCCGTGCGGCGACGATC
TGGAGTACGACGCGGCCTTTACCGCGCTCACCACCGCAGCGCAGGGCAAGCCCGAGCAGCAGTTCGGCGA
CACCGTCATCCCCGCGGTGGAGCCGGAGTGGCGCGAGGTGGCCGAACAGTCCGATGCGATCCTGCGCCGC
AGCAAGGACGTGCGCGCCGCCGTGCTGCTGCTGCGTGCTTCCACGCGGCTGCAGGGACTTGCCGGTTTCG
TTGCCGGGCTCGAACTGCTCACCCGCCTGCTCGACAACTTCTGGGACGGCATACATCCAAAGCTCGATGC
CGAGGACGACAACGATCCCACCATGCGCCTGAACGCGCTCGCGCCGCTCGGCGACGAGACGATGGTCCTG
CGCGACCTGTACGACGCGCAGGTGGGCGTGGCACCCGGCGTGGGCGCGATCCGCGTGCGCGACATCGCGG
TAGCCAACAACGCATTGAATGCGGTGGGCGGCGAAGCCACCTATTCGCCGGCACAGATCCAGGGCGGCCT
CGAGGCGCTCCATGCCGAGCGGCCCGAGCTGATCCAGGCCGCCATCGGCGTGCCCGGCGGGGTCGAGAAG
CTGCAGGCCCTGCTGGTGGAGCGCACCGGCCGCTCCGACGCGATCGACCTCTCCCCGCTGCGCGCCATCG
GCCGCATGCTGCAGAAGGCGTGCAGCGCGGCCATCGGTGCGCCCGAAGAAGCCGGCACCGCCGAAGAGGC
GCAAGGCGATGCGCCGCAGGCCGGCGGCGCGCCGCGGCCCGCTGCCATGCGCGGCGAGATCCAGAGCCGG
CAGGACGCGCTGCAGATGCTGGACCGCGTGATCCGCTTTCTCGAGCAGACCGAGCCCGGCAACCCCGCCC
CGCTCCTGATCGAGCGCGCCAAGAAGCTCATCGGCGTGAGCTTTCTCGAAATCATGGCCAACCTCGCGCC
CGGCGCGCTGGACACGATCGAGACCGTGACCGGCAAGCGTCCGTCCGAGTAG
 Primer design