SecReT6
Protein ID: 239813571
SecReT6 ID348
T6SS typei3
Gene symbol-
Locus tagVapar_0552
StrainVariovorax paradoxus S110
Repliconchromosome I [GenBank: NC_012791] [Browse all T6SS(s) in this replicon]
Location [Strand]611845..612360 [+]
Producttype VI secretion lipoprotein
NoteTssJ
UniProt IDC5CKB7
KEGG IDvap:Vapar_0552
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 5.10E-41, Aligned region: 33..165
Protein Sequence: 171 a.a.     [Download]
>gi|239813571|ref|YP_002942481.1| type VI secretion lipoprotein [Variovorax paradoxus S110]
MRTLGTHHSSYGRSFAAVSRRVALASGLALTGALIAGCASKPVVTPVSITLAAGADANPDARGRASPLTV
RIYALKSPGPFEGADFFSLFEKDQATLGAELVQREEMLLRPGESRKLDLTLPADAKAIGVMAAFRDLDRA
RWREVRAVEPGKPQTLTVTFGARQIRIDSSK
 
Nucleotide Sequence: 516 bp     [Download]
>gi|239813019|ref|NC_012791.1|:611845-612360 Variovorax paradoxus S110 chromosome 1, complete sequence
ATGCGCACGCTGGGTACACACCATTCGTCCTATGGACGCTCTTTTGCTGCGGTCTCGCGGCGCGTTGCAT
TGGCCTCTGGCCTCGCATTGACCGGTGCCCTGATCGCAGGCTGCGCAAGCAAGCCCGTGGTCACGCCGGT
GTCGATCACGCTCGCGGCCGGTGCCGACGCCAACCCCGATGCGCGCGGCCGCGCATCGCCGCTCACGGTG
CGCATCTATGCGCTGAAGTCGCCCGGCCCCTTCGAAGGGGCCGACTTCTTCTCGCTGTTCGAAAAGGACC
AGGCCACGCTCGGCGCCGAGCTGGTGCAGCGCGAAGAGATGCTGCTGCGCCCGGGCGAAAGCAGAAAGCT
CGACCTCACGCTGCCGGCCGATGCCAAGGCCATTGGCGTGATGGCCGCGTTCCGCGATCTCGACCGTGCG
CGCTGGCGCGAAGTGCGCGCGGTGGAGCCCGGCAAGCCGCAGACGCTCACCGTGACCTTCGGCGCGCGGC
AGATCCGCATCGACAGCAGCAAATAA
 Primer design