SecReT6
Protein ID: 241663267
SecReT6 ID349
T6SS typei3
Gene symbol-
Locus tagRpic12D_1672
StrainRalstonia pickettii 12D
Repliconchromosome I [GenBank: NC_012856] [Browse all T6SS(s) in this replicon]
Location [Strand]1774621..1775916 [-]
ProductOmpA/MotB domain-containing protein
NoteTagL
UniProt IDC6BJ32, C6BJ32
KEGG IDrpf:Rpic12D_1672
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 1.60E-18, Aligned region: 311..407
DUF2077 [PF09850], Evalue: 9.50E-18, Aligned region: 9..136
DUF2077 [PF09850], Evalue: 9.50E-18, Aligned region: 215..250
Protein Sequence: 431 a.a.     [Download]
>gi|241663267|ref|YP_002981627.1| OmpA/MotB domain-containing protein [Ralstonia pickettii 12D]
MASQPQSKNPLLRLAQPLFWLLDELSPELESAARLDALKSEVRTRLAAFKQAAQAAALKADSVEAVHYCF
CAALDQAGSRVRGRADGLRGVWLHHGLLMQLYGEKDFGQRCRSWITKLQETPNASENALGVIAQLMERGL
RDERGMPLPKIQLVHQWSPVEVIPSAATTPQRRHVTIANSAAEHQRIHVAVSNPSGGAVEPSDVLITVGM
PVQEAAPSQELSPQRSWRLIVIAVVVTALVIGLAWVTYRQHLDNQALASQVSALEAQVAKRQEPLEDRIA
RALTSETGASQFGLSTEGDRIYIVFSSGMGFAAGSADITPMLARQLERLAGVLTTDGKVTIVGHTDDSPG
ARGRTETNLALSAARAMAVGRNLQAHGLSETRLSTMGRGAKEPVGDNKTAEGRALNRRVEIVLDRQRASV
PERASPTTAGD
 
Nucleotide Sequence: 1296 bp     [Download]
>gi|241661625|ref|NC_012856.1|:c1775916-1774621 Ralstonia pickettii 12D chromosome 1, complete sequence
ATGGCCAGTCAACCACAATCCAAGAACCCCTTGCTCCGGCTTGCCCAGCCTTTGTTCTGGCTGCTGGACG
AACTGTCTCCCGAGCTGGAGTCGGCGGCCCGCCTGGATGCGCTCAAATCTGAAGTGCGCACGCGACTGGC
CGCCTTTAAACAAGCAGCCCAGGCAGCCGCGCTCAAGGCGGATTCTGTAGAGGCGGTGCATTACTGCTTC
TGCGCGGCCCTGGATCAGGCGGGTAGCCGCGTGCGTGGGCGCGCGGATGGCTTGCGCGGTGTTTGGCTTC
ACCACGGCTTGCTGATGCAGCTCTATGGCGAGAAGGATTTTGGTCAACGCTGCCGCTCCTGGATCACCAA
GCTGCAGGAGACACCCAACGCCAGCGAGAATGCGCTGGGGGTAATTGCGCAACTCATGGAGCGTGGCTTG
CGGGACGAGCGGGGCATGCCGCTTCCCAAAATCCAGCTTGTGCACCAATGGAGCCCCGTGGAGGTCATCC
CGTCAGCCGCGACGACTCCGCAGCGCCGACACGTGACGATTGCCAATTCGGCGGCCGAGCACCAGCGCAT
TCATGTTGCCGTCAGTAATCCTAGCGGTGGTGCGGTAGAACCATCGGATGTGCTGATCACCGTCGGCATG
CCCGTGCAAGAGGCAGCGCCGTCCCAAGAGCTGTCACCCCAGCGCTCATGGCGCCTGATCGTGATAGCAG
TGGTGGTGACGGCGCTTGTTATTGGCCTTGCATGGGTGACCTATCGCCAGCATCTCGACAACCAGGCGCT
GGCAAGCCAAGTCAGTGCGCTGGAGGCACAGGTCGCCAAGCGGCAGGAACCCCTAGAAGACCGCATCGCT
CGTGCGTTGACCTCGGAAACCGGGGCCAGCCAGTTTGGCTTGAGCACCGAAGGCGACCGCATTTACATCG
TCTTCAGCAGCGGCATGGGTTTTGCTGCTGGCAGCGCCGACATTACGCCGATGCTAGCGCGCCAGCTTGA
ACGCCTCGCTGGCGTACTCACCACCGATGGCAAGGTGACGATCGTGGGGCATACCGACGATTCGCCCGGT
GCGCGCGGCCGCACGGAAACCAATCTGGCCCTGTCGGCTGCCCGCGCCATGGCAGTGGGGCGCAATCTGC
AGGCGCATGGCTTGTCGGAGACTCGTTTGTCAACCATGGGCCGAGGTGCAAAGGAGCCCGTTGGCGACAA
CAAGACTGCAGAGGGCAGGGCGTTGAATCGGCGTGTGGAAATCGTACTCGATCGCCAACGCGCTTCGGTT
CCTGAGAGAGCTAGTCCAACCACCGCCGGCGACTAA
 Primer design