SecReT6
Protein ID: 241663268
SecReT6 ID349
T6SS typei3
Gene symbol-
Locus tagRpic12D_1673
StrainRalstonia pickettii 12D
Repliconchromosome I [GenBank: NC_012856] [Browse all T6SS(s) in this replicon]
Location [Strand]1775916..1779722 [-]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDC6BJ33
KEGG IDrpf:Rpic12D_1673
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 6.10E-93, Aligned region: 577..892
ImcF-related_N [PF14331], Evalue: 2.20E-87, Aligned region: 256..528
DUF1215 [PF06744], Evalue: 3.50E-30, Aligned region: 1001..1125
Protein Sequence: 1268 a.a.     [Download]
>gi|241663268|ref|YP_002981628.1| type VI secretion protein IcmF [Ralstonia pickettii 12D]
MEFLKRLRNALFSWQMLLLLAILLVAAAVWWIGPLLSFDGIVPLAGVGVRVAVIALLLALYVFVVWGWPV
FFLAATALCLLIWHAGPLLALNAHRPLQDTTPRLLLIAVIVLVSVVYLFALLWRSIRSGGVVRKWLDAKT
DDEEEVAPESDVKAVTSSVDAAMRQLKALRTRSGLGRLFEGRRYLYELPWFLTLGIASTGKTSVLSNAGL
RFPLASGAGSPGRAEEDRKAPVWRFSNEAVLIDPVGNYTSQDRKPAAVKAEWSRFLDLLRKYRGRAPING
AVVTVSVADLVRQTAQERADEALKIRHRLIELRQELGIQFPIYVVVTKLDLLPGFAQYFQYLGSEGRAQS
WGFGLPAAHRPKRGETAHAIGALCRTEMAALEARLIAGETDRFNEEFDAGRKKALLGLAEEFDALTNPLA
DLVDQIFENSRYDNTQHNAMLRGVHFTSAAQTGASVNAADDTVTLQVLDAKALDEEQDANATTSSGSYFL
QDLFKRGVFPEAHLVRPNLRWEFRFRLMRLLAHALVLMIFLWLVAGFYLSFGHNTHYLDVVKEKTHALAA
RVTAFYKKPEPEGTPVLLAEANDLAAFPGLVLSEPPLHWRYGLYVAPQVLAAAMGTHVKLEDNLLVPYLV
RRVETVLSAAIADKDAKLTYDTLRVYLMLYDKDSFNALDVRGWVQSDWATGGGADAFGGRIAAVEHLNSL
LDGTRPIHSPYAKNEDLIRSARDFLDGNTSTERLYDRAKAAMMEGAPADFTLVRAIGPQAGTVFSRASGE
PLERGIPGLFTYAGYHKVFNTRLPEFVNKAQAIDAWVMGRPGAQKKTLESAAGRLTGDDPVSREIRRLYL
TEYAQRWSEFLSDIRALTGNNLAFDLEVLRNFAAPDSPLARLGRVVVRETTLSQPTEPEDKSLADKALAV
LDSKSDKISGFAARAEARQERELVDNRFAALREVVTGQADVAAPNAQTKGGQPRLDAIAGMVNAYYTSLM
VASNALETRNLPPSAEAGAQLKMEAAKLPAPLKEVLADLVVQGTRDVNKGIGDILIAQMNAVIGESCRSA
IDGKYPFTPTSAQDVDTEDFARVFATGGVLDDFFQKVLAPHVDTTISPWRYKLSAPDVPPVAGPSLIPFQ
RAKEIREVFFRDPGAKKMAWKVDLKVVELDPEIVELNMDFDGQGLRYVHGPVIPLKVTWPGPRGGQGAEI
TANPRVRPETSTLTANGPWAMMRVIAKGKLASSVSNSHFIAEYDFDGRKAKLDINTGSLANPWTTGLLQG
FQCPGRSG
 
Nucleotide Sequence: 3807 bp     [Download]
>gi|241661625|ref|NC_012856.1|:c1779722-1775916 Ralstonia pickettii 12D chromosome 1, complete sequence
ATGGAATTCTTGAAACGACTGCGCAACGCGCTCTTTAGCTGGCAGATGCTGCTCCTGCTGGCGATCCTGC
TGGTCGCGGCGGCCGTCTGGTGGATTGGCCCGCTGCTGAGCTTTGATGGCATCGTGCCCCTGGCGGGTGT
CGGCGTACGCGTGGCGGTGATTGCCTTGCTGCTGGCGCTCTATGTCTTTGTGGTCTGGGGGTGGCCCGTG
TTCTTTCTGGCAGCGACGGCCCTGTGCCTGCTGATCTGGCACGCTGGCCCGTTGCTGGCCTTGAACGCAC
ACCGTCCGCTGCAAGATACAACACCCCGTCTCCTGCTCATTGCCGTCATCGTTCTCGTGTCGGTTGTCTA
CCTGTTTGCGTTGCTCTGGCGCAGTATTCGTTCAGGTGGCGTGGTCCGGAAATGGCTGGATGCCAAGACC
GACGACGAAGAAGAGGTGGCCCCCGAGTCTGATGTCAAAGCCGTCACCAGTAGCGTGGATGCCGCCATGC
GCCAGTTGAAGGCACTGCGCACCCGCAGCGGCCTGGGTCGGCTGTTCGAGGGGCGACGCTATCTGTACGA
ACTGCCGTGGTTCCTGACCCTGGGTATTGCCAGCACCGGCAAGACCAGCGTACTGAGCAATGCCGGCCTG
CGCTTCCCGCTGGCAAGCGGCGCCGGTTCGCCCGGTCGCGCGGAGGAAGACCGCAAGGCACCCGTCTGGC
GTTTCAGCAATGAAGCCGTGCTGATCGACCCAGTCGGCAACTACACCAGCCAAGACCGCAAGCCCGCGGC
TGTCAAAGCCGAGTGGAGCCGCTTCCTCGATCTGCTGCGCAAGTATCGAGGCCGCGCGCCCATCAACGGC
GCGGTGGTCACCGTCAGCGTGGCGGATCTGGTCCGCCAGACCGCACAGGAACGTGCCGACGAAGCGCTCA
AGATCCGCCACCGTCTGATCGAGTTGCGCCAAGAGCTGGGCATCCAGTTCCCGATCTATGTCGTGGTAAC
CAAGCTCGACCTGTTGCCTGGCTTTGCCCAGTACTTCCAATACCTGGGAAGCGAGGGGCGGGCGCAGTCG
TGGGGCTTTGGCCTACCGGCGGCGCATCGCCCCAAGCGTGGCGAGACCGCCCACGCCATCGGCGCACTAT
GCCGCACCGAGATGGCCGCGTTGGAAGCGCGTCTCATCGCCGGCGAGACCGATCGCTTCAACGAAGAGTT
CGACGCTGGCCGCAAGAAAGCACTGCTGGGCCTGGCCGAAGAGTTCGATGCCCTGACCAACCCGCTGGCC
GATCTGGTTGACCAGATCTTTGAAAACTCCCGCTACGACAACACGCAACACAACGCGATGCTGCGAGGCG
TGCATTTCACCAGTGCGGCGCAGACCGGTGCATCGGTCAATGCCGCCGACGACACAGTGACGTTGCAGGT
GCTGGACGCCAAGGCGCTCGACGAGGAACAAGATGCCAACGCCACGACAAGCTCCGGCAGCTACTTCTTG
CAGGACCTCTTCAAGCGAGGCGTCTTCCCCGAGGCACACCTGGTGCGCCCGAACCTGCGTTGGGAGTTCC
GCTTTCGCCTGATGCGTCTGCTGGCCCACGCGCTGGTGTTGATGATCTTCTTGTGGCTGGTGGCTGGTTT
CTATCTGAGCTTTGGGCACAACACCCACTACCTCGACGTCGTGAAGGAGAAAACGCACGCACTGGCTGCC
CGGGTCACCGCCTTCTACAAAAAGCCCGAGCCTGAAGGCACGCCGGTGCTCCTGGCCGAAGCCAACGACC
TAGCGGCCTTTCCGGGCCTGGTCCTGTCGGAGCCACCGCTGCACTGGCGTTACGGCTTGTATGTCGCGCC
GCAGGTGCTGGCTGCCGCCATGGGGACCCACGTCAAGCTGGAAGACAACCTGCTAGTGCCCTACCTGGTG
CGCCGTGTGGAAACCGTGCTCTCCGCTGCCATCGCCGACAAGGATGCCAAGCTGACCTACGACACCTTGC
GCGTCTACCTGATGCTGTACGACAAGGACAGCTTCAACGCGTTGGACGTACGCGGCTGGGTGCAAAGTGA
TTGGGCCACCGGCGGTGGCGCGGACGCCTTTGGTGGCCGGATTGCCGCGGTCGAGCACCTCAACAGCCTG
CTCGATGGCACGCGCCCAATTCACTCGCCGTATGCCAAGAACGAAGACCTGATCCGTTCCGCGCGGGACT
TCCTGGACGGCAATACTTCCACTGAGCGTTTGTACGACCGAGCCAAGGCCGCCATGATGGAGGGGGCACC
GGCGGACTTCACGCTCGTGCGAGCCATCGGTCCGCAAGCTGGCACGGTGTTCTCCCGTGCCAGCGGCGAG
CCACTGGAGCGCGGCATCCCTGGCCTGTTTACCTACGCGGGGTATCACAAGGTGTTCAACACCCGACTGC
CGGAGTTCGTCAACAAGGCACAGGCCATCGATGCTTGGGTGATGGGACGCCCTGGCGCTCAAAAAAAAAC
GCTTGAGAGCGCAGCGGGCAGGCTGACGGGCGACGATCCCGTGTCCAGGGAGATTCGCCGCCTGTACTTG
ACCGAATACGCACAACGCTGGTCGGAATTCTTGTCCGACATCCGAGCGTTGACCGGCAACAACCTCGCCT
TTGACCTCGAAGTCCTGCGCAACTTCGCCGCCCCCGATTCGCCGCTGGCGCGTCTGGGGCGCGTGGTGGT
GCGCGAGACCACGCTGAGCCAGCCGACCGAGCCGGAAGACAAGTCCCTCGCGGACAAGGCGCTGGCCGTC
TTGGACAGCAAGTCCGACAAGATCAGCGGTTTCGCAGCCCGCGCCGAAGCCCGGCAAGAACGTGAACTGG
TCGACAACCGCTTCGCCGCCCTGCGCGAAGTCGTGACCGGCCAGGCCGATGTGGCGGCACCCAATGCCCA
GACCAAAGGCGGTCAGCCACGGCTGGACGCCATCGCCGGCATGGTCAATGCCTACTACACGTCACTGATG
GTGGCCAGTAACGCGCTGGAGACCCGCAACCTGCCGCCATCAGCCGAGGCGGGCGCCCAATTGAAGATGG
AAGCCGCCAAGCTGCCGGCCCCGCTCAAAGAGGTGCTGGCCGATCTGGTGGTGCAGGGCACGCGTGACGT
CAACAAGGGCATTGGCGACATCCTGATTGCGCAGATGAACGCAGTCATTGGCGAAAGTTGCCGCAGCGCC
ATCGACGGCAAATATCCCTTCACGCCGACCTCCGCTCAGGACGTGGATACCGAGGATTTCGCGCGCGTCT
TTGCGACGGGCGGTGTGCTGGACGATTTCTTCCAGAAGGTGCTGGCACCACACGTGGATACGACGATCTC
GCCTTGGCGTTACAAGCTGAGCGCACCCGACGTGCCACCCGTGGCGGGTCCTAGCCTCATCCCGTTCCAG
CGTGCCAAGGAAATCCGCGAAGTGTTCTTCCGTGACCCGGGCGCCAAGAAGATGGCCTGGAAGGTGGATC
TGAAGGTCGTGGAGCTGGATCCGGAAATCGTTGAACTGAACATGGACTTCGACGGCCAAGGCCTGCGCTA
TGTGCACGGCCCCGTAATCCCGCTCAAGGTCACGTGGCCCGGCCCGCGCGGCGGGCAGGGCGCGGAGATC
ACGGCCAACCCGCGCGTGCGGCCCGAGACTTCGACACTCACTGCCAACGGACCATGGGCCATGATGCGCG
TGATTGCCAAGGGCAAGCTCGCCAGCTCGGTATCGAACAGCCACTTCATCGCCGAGTATGACTTCGATGG
GCGTAAGGCCAAGCTCGACATCAATACAGGCAGCTTGGCGAATCCATGGACGACCGGACTGCTGCAAGGC
TTCCAGTGCCCGGGGAGGTCTGGCTGA
 Primer design