SecReT6
Protein ID: 241663269
SecReT6 ID349
T6SS typei3
Gene symbol-
Locus tagRpic12D_1674
StrainRalstonia pickettii 12D
Repliconchromosome I [GenBank: NC_012856] [Browse all T6SS(s) in this replicon]
Location [Strand]1779735..1780982 [-]
Producttype VI secretion system OmpA/MotB family protein
NoteTssL
UniProt IDC6BJ34
KEGG IDrpf:Rpic12D_1674
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 5.50E-58, Aligned region: 44..249
OmpA [PF00691], Evalue: 9.90E-17, Aligned region: 309..407
Protein Sequence: 415 a.a.     [Download]
>gi|241663269|ref|YP_002981629.1| type VI secretion system OmpA/MotB family protein [Ralstonia pickettii 12D]
MQEPAAQPSPEPVRSASTRAANEPRQIKRKPIEQRVEKAKQAVNPVLSAARPLLRALADMPSTLRVDQAA
LLKDVLEQELHDFQTVCERVGIRSEHTLAAHYSLCTALDEAALGTPWGSNGSWAKDSLLVKHHGGTDGGT
KVFQVLGRLVNSPEEHIDVIELIYYLLSLDFQGRYRGPAEGERQHLAIRQSLHTLIRKHRGAVPRELSPN
LPVIPAGRFSMIRTVPIWFSATVLGMAAFGLFGWYKYQLSLRTHDLEQQIQAIGQITPPPPPKVVLRLAE
LLKDEIARGQVKVEEDATHSAVTFRGDDMFAGGRADVNAKVQPLLDKIASEITKVPGKVTVTGHSDNQPI
KTAKFPSNQVLSEERAVHVSEYLASRGVAQGRLEAVGKGDTEPVADNSTWNGRAANRRVQIDVTQ
 
Nucleotide Sequence: 1248 bp     [Download]
>gi|241661625|ref|NC_012856.1|:c1780982-1779735 Ralstonia pickettii 12D chromosome 1, complete sequence
ATGCAAGAGCCAGCAGCGCAGCCTAGCCCCGAGCCGGTACGCTCTGCCTCCACCCGAGCTGCCAACGAAC
CACGACAGATCAAGCGCAAGCCGATCGAGCAACGTGTCGAGAAAGCCAAGCAGGCAGTCAACCCGGTACT
GTCCGCCGCGCGGCCCTTGCTGCGCGCCCTGGCGGATATGCCGAGCACACTGCGCGTCGATCAGGCCGCG
CTTCTGAAAGACGTGCTTGAACAAGAGCTGCACGACTTCCAGACCGTCTGCGAACGGGTGGGCATTCGGT
CCGAGCACACCCTTGCCGCACACTACAGCCTGTGCACCGCCTTGGATGAAGCGGCTTTAGGCACACCATG
GGGCAGCAATGGTTCCTGGGCGAAGGACAGCCTGCTCGTCAAACACCATGGCGGCACTGACGGCGGCACC
AAGGTCTTCCAAGTGCTCGGCCGGCTGGTCAACAGCCCTGAAGAGCACATCGACGTCATCGAGCTGATCT
ACTACCTGCTCTCGCTCGATTTCCAGGGCCGCTATCGTGGCCCCGCTGAGGGCGAGCGGCAACACCTGGC
GATTCGGCAGAGCCTGCATACCCTGATCCGCAAGCATCGCGGCGCCGTGCCCAGGGAACTGTCCCCGAAT
CTGCCCGTGATACCGGCAGGGCGCTTCTCCATGATTCGCACCGTCCCGATCTGGTTCAGCGCCACCGTGC
TGGGCATGGCCGCCTTCGGCTTGTTTGGCTGGTACAAGTACCAGCTCTCGCTGCGCACGCACGATCTGGA
ACAACAGATCCAGGCCATCGGGCAGATCACCCCGCCGCCACCGCCAAAGGTGGTCCTGCGTCTGGCCGAA
CTGCTCAAGGACGAAATCGCTCGTGGCCAGGTCAAGGTGGAGGAAGATGCCACCCACAGCGCCGTCACCT
TCCGTGGCGACGACATGTTTGCCGGCGGTCGCGCGGACGTGAACGCCAAGGTCCAGCCCCTGCTGGACAA
GATCGCCTCGGAAATCACCAAGGTACCCGGCAAGGTAACCGTCACCGGGCACAGTGACAACCAGCCCATC
AAGACGGCTAAGTTCCCTTCCAACCAGGTGCTCTCGGAAGAGCGTGCCGTGCACGTCTCTGAATACCTCG
CCTCGCGTGGCGTGGCACAGGGCCGGCTCGAAGCCGTGGGCAAGGGCGACACCGAACCCGTGGCCGATAA
CTCGACTTGGAATGGCCGGGCAGCGAACCGCCGCGTGCAGATCGACGTCACGCAGTAA
 Primer design