SecReT6
Protein ID: 241663270
SecReT6 ID349
T6SS typei3
Gene symbol-
Locus tagRpic12D_1675
StrainRalstonia pickettii 12D
Repliconchromosome I [GenBank: NC_012856] [Browse all T6SS(s) in this replicon]
Location [Strand]1781021..1782364 [-]
Producttype VI secretion protein
NoteTssK
UniProt IDC6BJ35
KEGG IDrpf:Rpic12D_1675
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.20E-150, Aligned region: 20..447
Protein Sequence: 447 a.a.     [Download]
>gi|241663270|ref|YP_002981630.1| type VI secretion protein [Ralstonia pickettii 12D]
MSWYNKVVWSEGLFLRPQLFQQQERYLEHFAHKRAAALSPFFWGFHHLAIDAEALALGKLVVSGAAGIFQ
DGTPFDAPAHAKLPAPLALRHEHLNQIIYLAVPIRTPNAEETSFEDAQDSLARYRSFEEDLLDANSIGQG
PKLVQLGDLRLRLMPEKELTESWLGMPLAKVTEIRADGSARLDAGLIPPANVYTASALLQTWLAEVHGLL
RLRATSMAERLTASSTRGGDAAEISEYLILQLFNRAEPVLEHMLAAKADSPEALYVQLTALAGELSTFVR
TATRRPNPDYPAYRHDEPHTCIKPVVDDLRFLLNVVLERGAQRIELRDQQHGIRLAVLDPAEFERFNTFV
LAVGAQLPSDVLQQQFPAQAKVGPAERLAELIRSHLPGIPLQAMPVPPRQIPFNAGQVYFELPQDHPLWA
QVQRYGGLALHVAGNFPELRLELWGVR
 
Nucleotide Sequence: 1344 bp     [Download]
>gi|241661625|ref|NC_012856.1|:c1782364-1781021 Ralstonia pickettii 12D chromosome 1, complete sequence
ATGAGCTGGTACAACAAAGTCGTCTGGAGCGAAGGGCTGTTTCTGCGCCCGCAGCTCTTCCAGCAGCAAG
AGCGCTACCTGGAGCACTTCGCCCACAAGCGTGCCGCTGCCTTGAGCCCATTCTTCTGGGGCTTCCACCA
CTTGGCGATCGATGCCGAAGCGCTCGCGCTGGGCAAGCTCGTGGTCTCGGGGGCCGCAGGCATCTTCCAG
GACGGCACACCGTTCGATGCACCGGCCCACGCCAAGCTGCCCGCTCCGCTGGCGTTGCGCCACGAGCACC
TGAACCAGATCATTTATCTGGCCGTGCCCATCCGCACCCCCAACGCCGAAGAAACCAGCTTCGAAGACGC
CCAGGATTCGTTGGCACGCTATCGCAGCTTTGAAGAAGACCTGCTCGACGCCAACTCCATCGGCCAAGGC
CCCAAGCTCGTGCAGTTGGGCGACTTGCGCCTGCGCTTGATGCCCGAGAAGGAACTGACCGAATCCTGGC
TTGGCATGCCGCTAGCCAAGGTGACAGAAATCCGTGCGGACGGCAGCGCCCGGCTCGATGCCGGACTGAT
TCCTCCGGCCAACGTCTACACCGCCAGCGCCTTGCTGCAAACGTGGCTGGCCGAAGTACACGGCCTGCTG
CGCCTGCGCGCCACCTCCATGGCCGAGCGCCTCACCGCCTCCAGCACCAGAGGCGGAGACGCCGCCGAGA
TTTCCGAATACCTCATCCTGCAACTGTTCAACCGGGCCGAACCCGTGCTTGAACACATGCTGGCCGCCAA
GGCCGATTCGCCCGAAGCCCTGTATGTCCAACTGACCGCGCTTGCCGGCGAGCTGTCCACCTTCGTGCGT
ACCGCCACCCGCCGCCCGAATCCGGATTACCCCGCTTACCGGCACGACGAGCCCCACACCTGCATCAAGC
CGGTGGTGGATGACCTGCGCTTCCTGCTCAACGTGGTACTGGAGCGCGGCGCCCAGCGCATCGAATTGCG
CGACCAGCAACACGGCATCCGTCTGGCGGTGCTGGACCCGGCCGAGTTCGAGCGGTTCAACACCTTCGTG
CTGGCCGTGGGCGCACAACTGCCCAGCGACGTGCTGCAGCAGCAGTTCCCCGCGCAAGCCAAGGTCGGCC
CGGCCGAGCGGCTGGCCGAACTCATCCGTTCGCACCTGCCCGGCATCCCGCTGCAGGCGATGCCCGTACC
GCCGCGCCAGATTCCGTTCAATGCGGGCCAGGTCTATTTCGAACTGCCGCAAGACCATCCTCTGTGGGCG
CAAGTCCAGCGCTACGGCGGCTTGGCCTTGCATGTGGCAGGGAACTTCCCCGAGCTGCGGCTTGAACTGT
GGGGGGTGCGTTAA
 Primer design