SecReT6
Protein ID: 241663271
SecReT6 ID349
T6SS typei3
Gene symbol-
Locus tagRpic12D_1676
StrainRalstonia pickettii 12D
Repliconchromosome I [GenBank: NC_012856] [Browse all T6SS(s) in this replicon]
Location [Strand]1782373..1782891 [-]
Producttype VI secretion lipoprotein
NoteTssJ
UniProt IDC6BJ36
KEGG IDrpf:Rpic12D_1676
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.70E-39, Aligned region: 20..166
Protein Sequence: 172 a.a.     [Download]
>gi|241663271|ref|YP_002981631.1| type VI secretion lipoprotein [Ralstonia pickettii 12D]
MFQQLSHRAWLLMLGVLSSALVACSTAPAQPEQMKLDLSIEAKDTLNPDDKGRASPVLVRLYELKTASTF
ENADYYALESTDRTMLVPDLLARDEFILRPGEFRDVERKLNPDTQVLGLLVGYRELGRATWRTVYKLPPA
PEAAWYRAAIPARKVKLQIVLDEQAITVSKPD
 
Nucleotide Sequence: 519 bp     [Download]
>gi|241661625|ref|NC_012856.1|:c1782891-1782373 Ralstonia pickettii 12D chromosome 1, complete sequence
ATGTTCCAGCAACTCAGCCATCGAGCATGGCTTCTGATGCTGGGGGTGCTGTCGTCCGCGCTGGTTGCGT
GTTCGACAGCCCCCGCCCAGCCCGAGCAAATGAAGCTCGACCTGTCCATCGAAGCCAAGGACACCCTCAA
CCCCGACGACAAGGGCAGGGCGTCCCCCGTGCTCGTGCGCCTGTACGAACTCAAGACCGCAAGCACCTTC
GAGAACGCCGACTACTACGCGCTCGAATCGACCGACCGCACGATGTTGGTGCCCGACCTGCTCGCGCGCG
ACGAATTCATCCTGCGCCCCGGCGAGTTCCGCGACGTCGAACGCAAGCTCAACCCCGACACGCAAGTGCT
CGGTCTCTTGGTTGGCTATCGCGAACTCGGCAGAGCCACCTGGCGCACCGTCTACAAGTTGCCGCCCGCA
CCCGAAGCTGCCTGGTACCGCGCCGCGATTCCCGCGCGCAAGGTCAAGCTGCAGATCGTCCTCGACGAGC
AAGCCATCACCGTATCCAAACCTGACTGA
 Primer design