SecReT6
Protein ID: 241663272
SecReT6 ID349
T6SS typei3
Gene symbol-
Locus tagRpic12D_1677
StrainRalstonia pickettii 12D
Repliconchromosome I [GenBank: NC_012856] [Browse all T6SS(s) in this replicon]
Location [Strand]1782894..1783169 [-]
ProductPAAR repeat-containing protein
NotePAAR
UniProt IDC6BJ37
KEGG IDrpf:Rpic12D_1677
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 7.10E-18, Aligned region: 8..86
Protein Sequence: 91 a.a.     [Download]
>gi|241663272|ref|YP_002981632.1| PAAR repeat-containing protein [Ralstonia pickettii 12D]
MSAQIITVGDVGDHGAVVITGSPTSKIRGRAIARLGDLVKCPGHYPDGRPHGINRIVRVSGTAKVGGSIM
ARAGDGTECGCTLIGSQPARA
 
Nucleotide Sequence: 276 bp     [Download]
>gi|241661625|ref|NC_012856.1|:c1783169-1782894 Ralstonia pickettii 12D chromosome 1, complete sequence
ATGTCCGCACAAATCATCACCGTAGGCGACGTTGGTGACCATGGCGCCGTCGTCATCACCGGCTCGCCCA
CCAGCAAGATTCGAGGCCGAGCCATCGCCCGCCTGGGCGATCTCGTTAAATGCCCCGGCCACTACCCGGA
CGGTCGCCCACACGGCATCAACCGCATCGTGCGCGTGTCCGGCACCGCTAAGGTCGGCGGCAGCATCATG
GCCCGCGCCGGTGACGGCACCGAATGTGGATGCACTCTGATCGGCAGTCAGCCTGCCCGAGCATGA
 Primer design