SecReT6
Protein ID: 241663274
SecReT6 ID349
T6SS typei3
Gene symbol-
Locus tagRpic12D_1679
StrainRalstonia pickettii 12D
Repliconchromosome I [GenBank: NC_012856] [Browse all T6SS(s) in this replicon]
Location [Strand]1783898..1787044 [-]
ProductImpA family type VI secretion-associated protein
NoteTssI
UniProt IDC6BJ39
KEGG IDrpf:Rpic12D_1679
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 5.90E-74, Aligned region: 41..360
DUF2345 [PF10106], Evalue: 2.80E-39, Aligned region: 639..792
T6SS_Vgr [PF13296], Evalue: 2.10E-34, Aligned region: 504..611
T6SS_Vgr [PF13296], Evalue: 2.10E-34, Aligned region: 862..905
Phage_base_V [PF04717], Evalue: 9.20E-19, Aligned region: 399..492
Protein Sequence: 1048 a.a.     [Download]
>gi|241663274|ref|YP_002981634.1| ImpA family type VI secretion-associated protein [Ralstonia pickettii 12D]
MGAAEQISNLVGSHRTVKAKSSAIPELLGAPQLEFVRVTGREALSELFTYTVDLRPVSLAADQSMLESDL
DAAIGQAMTLSIELDGMGDGVLGGIGAGERQITGLITAVELIGGVDNNRLYRYTLRPWLWLATQTSDYKP
FQNKSVIDILDEVLADYPYSVDKRLDTSVFPKLIWEVQHGETDALFIQRLTEEWGITYFFEHDGGHHRLV
LVSESGAWRQFPSEAYHTLPIYPQGFKVDQEHLTRFEPINRLRTGKITLKDYDPRQPRADLTTGDSLPRN
TLFSEFERYEYEPAVYNSREAGNFRARIRMEERRAKGRRTRGTGALRGVAAGHTYQIANHDHDALNREWL
IIGTEFMLEDVGLKGGSTQRYACHVRFEAHPTDEVFRPPLTAPKPRVQGIQRAVVTGPENQEVWCNDHGY
VKVQFEWDRYGQYDENSSPWIRVSNGWSGDQFGAMHVPRIRQEVLVDYLNGDPNTPIIIGRVPNQLNTPP
WSLPTQHALSGVASKELFGQRRNHLLMDDTQGEIQAQLSSDHQTSQLNLGYLTSVRGNPGRKDQRGEGFD
LRTDGHGSVRGGKGLFLTAEGQINAVGGHLSRDEFIRCMKAALEVAESLGGYSSQHEAPKTDTDPQSSLA
KAVQEWDAGANDHKEAPGQGGQPLLGAYAPAGMAFASPQTITSYAGKHIDTVSKLNQQVTAGQQYVVNGG
TGISLFAHSGFWKGIAHRGKLILQSQSDGMDFNAKTDVVVTATDGSILGNAKNGITLMSGNAGIRIADGC
VDIFGPTRVHAHTGNFDVPGPQGIQGALPQFDSGDTGRKFRLIRPADSLPVAGMAYQIVKQDGSVVKGVT
NSLGETGLHESEAAEALSISFGDELPSQEARMVRTSLTLGDSNRKSDSGYQYKLKQSTYQIKQAAYLPIE
GVGALATFVVHGNLNLKTGESGDSLWVNGMGTTSASSKGKTIFFAKASLRINGIDGAATPLATNNEAGFW
PKDGSLPIGSATLRLPRPDQSLKVELVLSGGYVYEGDEGRSVPIPPQGSIVIPIGIVYAEGKSGGINV
 
Nucleotide Sequence: 3147 bp     [Download]
>gi|241661625|ref|NC_012856.1|:c1787044-1783898 Ralstonia pickettii 12D chromosome 1, complete sequence
ATGGGCGCAGCAGAGCAGATTTCCAACTTGGTGGGCAGCCACCGCACAGTCAAAGCGAAAAGCAGCGCGA
TTCCCGAGTTGCTGGGCGCGCCGCAGTTGGAATTCGTGCGCGTCACCGGTCGCGAAGCCCTGAGCGAATT
GTTCACCTACACAGTGGATCTGCGCCCCGTCTCGCTCGCCGCCGATCAGTCCATGCTTGAATCCGATCTC
GATGCCGCTATCGGCCAAGCGATGACGTTGTCGATTGAACTCGATGGCATGGGCGATGGGGTGCTGGGCG
GCATTGGCGCGGGCGAGCGCCAGATCACCGGCCTGATCACCGCCGTCGAGTTGATCGGCGGCGTGGACAA
TAATCGCCTCTACCGCTACACCCTGCGCCCTTGGCTCTGGCTAGCGACGCAGACCTCCGACTACAAACCA
TTCCAGAACAAGTCCGTCATCGACATCCTCGATGAAGTGCTGGCCGACTACCCGTACTCCGTCGACAAAC
GTCTGGACACCAGTGTCTTCCCCAAGCTGATTTGGGAAGTGCAGCACGGCGAAACCGACGCCCTCTTCAT
CCAACGCCTCACTGAAGAATGGGGCATCACCTACTTCTTCGAACACGACGGTGGTCACCACCGACTCGTG
CTCGTCTCCGAATCCGGCGCCTGGCGTCAATTCCCCAGCGAGGCCTATCACACGCTGCCCATTTACCCGC
AAGGCTTCAAGGTAGACCAAGAGCACCTGACACGCTTCGAGCCAATCAACCGCCTGCGCACCGGCAAGAT
CACCCTCAAAGACTACGACCCGCGCCAGCCCAGGGCCGACCTCACCACCGGCGACAGCCTCCCGCGTAAC
ACATTGTTCTCCGAGTTCGAGCGCTACGAATACGAACCCGCCGTCTACAACAGCCGCGAAGCCGGCAACT
TCCGCGCCCGCATCCGCATGGAAGAGCGCCGCGCTAAAGGCCGGCGCACCCGTGGCACCGGTGCATTGCG
TGGCGTCGCCGCTGGCCACACTTACCAGATCGCCAACCACGACCACGACGCACTCAACCGTGAATGGCTC
ATCATCGGCACCGAGTTCATGCTCGAAGACGTGGGCCTGAAGGGTGGCAGCACCCAACGCTACGCCTGCC
ATGTCCGATTTGAAGCCCACCCCACTGACGAAGTCTTCCGCCCACCGCTGACGGCGCCCAAGCCACGCGT
GCAAGGCATCCAGCGCGCCGTGGTCACCGGCCCCGAGAACCAGGAAGTCTGGTGCAACGACCACGGCTAC
GTCAAAGTCCAATTCGAATGGGACCGCTACGGCCAGTATGACGAAAATTCGTCCCCCTGGATTCGCGTCT
CCAACGGTTGGTCTGGCGACCAGTTCGGCGCCATGCACGTGCCGCGCATCCGGCAGGAAGTGCTGGTCGA
CTACCTCAACGGTGATCCGAACACACCCATCATCATCGGGCGCGTTCCCAACCAGCTCAATACACCCCCG
TGGAGTCTGCCAACGCAGCACGCCCTGTCGGGTGTCGCCAGCAAGGAGCTGTTCGGACAGCGGCGCAACC
ACCTGTTGATGGACGACACGCAAGGCGAGATTCAAGCCCAACTGTCGTCCGACCACCAGACCAGCCAGCT
CAACCTCGGGTACCTCACCAGCGTCCGCGGCAACCCAGGGCGCAAAGACCAACGCGGTGAAGGTTTTGAC
CTGCGTACCGATGGCCACGGCAGTGTGCGTGGTGGCAAGGGCCTCTTCCTGACCGCAGAGGGCCAGATCA
ACGCCGTGGGTGGTCACCTCTCGCGCGACGAATTCATCCGCTGCATGAAAGCCGCACTGGAAGTTGCCGA
ATCATTGGGTGGCTACAGCAGCCAGCACGAAGCACCAAAGACTGACACCGATCCACAAAGCAGTCTGGCC
AAGGCCGTCCAGGAATGGGATGCGGGAGCCAACGATCACAAGGAAGCGCCGGGGCAGGGCGGCCAACCGC
TGCTGGGTGCGTACGCTCCCGCTGGTATGGCCTTCGCCAGCCCCCAAACCATCACCAGCTACGCCGGCAA
GCACATCGACACCGTCTCCAAGCTCAACCAGCAGGTCACGGCCGGTCAGCAATACGTTGTCAATGGCGGT
ACCGGGATCAGCCTGTTTGCGCACAGTGGATTCTGGAAAGGTATCGCCCACCGCGGCAAGCTCATTCTGC
AATCACAGAGTGATGGCATGGATTTCAACGCCAAGACCGACGTAGTGGTGACTGCTACCGACGGCAGCAT
CTTGGGTAATGCCAAGAATGGCATCACGCTCATGAGTGGCAATGCGGGCATTCGTATCGCCGACGGGTGT
GTGGACATCTTTGGGCCGACACGCGTGCATGCGCATACGGGGAACTTTGATGTACCGGGGCCTCAGGGTA
TCCAAGGAGCACTGCCGCAGTTCGACTCGGGGGACACCGGGCGCAAGTTCCGCCTGATCCGGCCGGCGGA
TAGCCTGCCGGTAGCTGGTATGGCCTATCAAATCGTCAAGCAAGACGGCAGCGTCGTAAAGGGCGTTACC
AATAGTCTGGGCGAAACCGGTCTGCACGAATCTGAAGCAGCGGAGGCGCTGTCAATCTCTTTTGGTGACG
AACTGCCGAGCCAGGAAGCAAGAATGGTCCGCACGTCGTTGACGCTGGGCGACAGCAATCGGAAGAGTGA
CAGCGGATACCAATACAAGCTCAAACAGTCGACCTATCAGATCAAGCAGGCCGCCTACTTGCCTATCGAG
GGTGTTGGTGCTCTCGCCACGTTCGTGGTCCACGGAAACCTCAACCTGAAAACCGGTGAGTCCGGCGATT
CTCTGTGGGTGAACGGCATGGGGACTACCAGCGCCAGCAGCAAGGGCAAGACCATCTTCTTTGCCAAGGC
ATCGCTACGCATCAACGGTATCGATGGAGCCGCTACCCCTTTGGCCACGAACAATGAAGCAGGCTTCTGG
CCAAAGGATGGCTCTCTTCCTATTGGCTCTGCAACCCTGCGGCTTCCGCGCCCCGATCAGTCACTCAAGG
TCGAGTTGGTGCTTAGTGGGGGTTACGTCTATGAGGGGGACGAAGGCCGCTCCGTGCCGATTCCGCCTCA
AGGTTCTATCGTCATACCGATCGGAATTGTCTACGCAGAAGGAAAGAGCGGGGGTATCAATGTCTAG
 Primer design