SecReT6
Protein ID: 241663276
SecReT6 ID349
T6SS typei3
Gene symbol-
Locus tagRpic12D_1681
StrainRalstonia pickettii 12D
Repliconchromosome I [GenBank: NC_012856] [Browse all T6SS(s) in this replicon]
Location [Strand]1787905..1788390 [-]
Producttype VI secretion system effector
NoteTssD
UniProt IDC6BJ41
KEGG IDrpf:Rpic12D_1681
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 5.20E-43, Aligned region: 6..136
Protein Sequence: 161 a.a.     [Download]
>gi|241663276|ref|YP_002981636.1| type VI secretion system effector [Ralstonia pickettii 12D]
MAQDIFLKINGIDGESQDSSHKNEIEVLVWDWNIEQQSNMHAGSGGGAGKATVSDLSFEHYVDRASPNLM
KYCLTGKHIDQATLVVRKAGGNPLEYLKLTMSDVIVTRVAPRGAATDEARVREKVALSFSKVKQEYMVQN
AQGGSGGAITAGYDIKGNKEA
 
Nucleotide Sequence: 486 bp     [Download]
>gi|241661625|ref|NC_012856.1|:c1788390-1787905 Ralstonia pickettii 12D chromosome 1, complete sequence
ATGGCACAGGACATCTTCCTGAAGATCAATGGCATCGACGGCGAATCTCAAGACTCGTCGCACAAGAACG
AAATCGAAGTGCTGGTGTGGGACTGGAACATCGAGCAACAGTCGAACATGCACGCCGGCAGCGGCGGCGG
TGCCGGCAAGGCCACCGTGTCGGACCTGTCGTTCGAGCACTACGTTGACCGTGCATCGCCCAACCTGATG
AAGTACTGCCTGACTGGTAAGCACATCGACCAAGCCACGCTGGTAGTGCGAAAGGCCGGCGGCAACCCGC
TGGAGTACCTGAAGCTCACGATGAGCGATGTGATCGTGACCAGGGTGGCACCGCGTGGTGCCGCGACCGA
CGAGGCACGTGTGCGCGAGAAGGTGGCGCTGTCGTTCTCCAAGGTCAAGCAGGAGTACATGGTGCAGAAC
GCCCAAGGCGGTAGCGGTGGGGCGATCACGGCAGGCTACGACATCAAGGGCAATAAGGAAGCCTAA
 Primer design