SecReT6
Protein ID: 241663277
SecReT6 ID349
T6SS typei3
Gene symbol-
Locus tagRpic12D_1682
StrainRalstonia pickettii 12D
Repliconchromosome I [GenBank: NC_012856] [Browse all T6SS(s) in this replicon]
Location [Strand]1788527..1790020 [-]
ProductEvpB type VI secretion protein
NoteTssC
UniProt IDC6BJ42
KEGG IDrpf:Rpic12D_1682
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.50E-194, Aligned region: 65..491
Protein Sequence: 497 a.a.     [Download]
>gi|241663277|ref|YP_002981637.1| EvpB type VI secretion protein [Ralstonia pickettii 12D]
MASAQQQKQQSVATADQSDFPALLNREFSPKTDQAREAVDLAVRTLAEQALASTFTMSDDAYKSIEAIIG
AIDSKLSEQINLILHNEDFQKLESAWRGLHHLVSNTETDEKLRIRVMDVSKDELRRTLRRYKGIGWDQSP
FFKRIYEEEYGQLGGEPYGCLVADYYFDHTPPDVELLGSLAKISAAAHAPFIAGASPSVLQMDSWQELAN
PRDLSKIFQNLEYAPWNSLRNSEDARYVGLAMPRFLSRLPYGIKTNPVDAFDFEEDTDGADHRKYVWSNA
AYAMAVNINRSFKQYGWCTLIRGVESGGVVENLPCHTFPTDDGGVDMKCPTEIAISDRREAELSKNGFIS
LVHRKNTDYAAFIGAQSLQKPAEYYDADATANANLSARLPYLFACSRFAHYLKCIVRDKIGAFKEREDMQ
RWLNEWVMNYVDADPANSSQETKARRPLAAAEVVVEEQEGNPGYYSAKFFLRPHFQLEGLTVSLRLVARL
PSVKEAA
 
Nucleotide Sequence: 1494 bp     [Download]
>gi|241661625|ref|NC_012856.1|:c1790020-1788527 Ralstonia pickettii 12D chromosome 1, complete sequence
ATGGCTTCCGCACAACAACAGAAACAACAGAGCGTCGCAACGGCTGATCAGTCCGACTTTCCGGCGCTAC
TGAACCGCGAGTTCTCCCCCAAGACCGACCAAGCCCGCGAGGCTGTTGATCTGGCCGTCCGCACCCTGGC
CGAGCAGGCGCTCGCCAGCACCTTTACCATGAGCGACGATGCCTACAAGAGCATCGAAGCCATCATCGGC
GCCATCGACTCCAAGCTCTCCGAGCAGATCAACCTAATCCTGCACAACGAAGACTTCCAGAAGCTCGAAT
CCGCTTGGCGTGGTCTGCATCACCTAGTCTCCAACACCGAGACGGATGAGAAGTTACGCATCCGTGTAAT
GGACGTCTCCAAGGATGAACTGCGCCGCACGCTGCGCCGCTACAAGGGCATCGGCTGGGACCAAAGCCCG
TTCTTCAAGCGCATCTATGAAGAAGAGTACGGCCAACTCGGCGGCGAACCGTATGGCTGCCTGGTTGCGG
ACTATTACTTCGACCACACACCGCCGGATGTGGAGCTGCTCGGTTCGTTGGCCAAGATCTCCGCCGCCGC
ACACGCCCCGTTCATTGCTGGTGCATCGCCATCGGTGCTGCAAATGGATTCGTGGCAAGAGCTGGCCAAC
CCGCGTGATCTGTCCAAGATCTTCCAGAACCTGGAGTACGCCCCGTGGAACAGCCTGCGCAACTCGGAAG
ATGCCCGCTACGTGGGTCTGGCCATGCCGCGTTTCCTCTCGCGCCTGCCGTACGGAATCAAGACCAACCC
GGTCGATGCCTTCGACTTTGAAGAGGACACCGACGGTGCCGACCACCGCAAGTACGTGTGGAGCAACGCG
GCGTACGCCATGGCCGTCAACATCAACCGCTCGTTCAAGCAATACGGCTGGTGCACGCTGATTCGCGGCG
TGGAGAGTGGCGGCGTGGTTGAGAACCTGCCGTGCCACACCTTCCCGACGGATGACGGTGGCGTTGACAT
GAAGTGCCCGACCGAGATCGCCATCTCAGACCGTCGCGAAGCCGAGCTGTCGAAGAACGGGTTCATCTCG
CTGGTGCATCGCAAGAACACCGACTACGCCGCCTTTATCGGCGCGCAGTCGCTGCAAAAACCGGCCGAGT
ACTACGACGCAGATGCCACGGCTAACGCCAACCTGTCGGCACGTCTGCCGTACCTGTTCGCCTGCTCGCG
CTTCGCGCACTACCTGAAGTGCATCGTGCGCGACAAGATCGGCGCGTTCAAGGAGCGCGAGGATATGCAG
CGCTGGTTGAACGAATGGGTCATGAACTACGTGGACGCCGATCCGGCCAACTCCTCGCAAGAGACCAAGG
CACGCCGCCCGCTGGCTGCCGCGGAAGTGGTGGTCGAAGAGCAGGAAGGCAACCCGGGCTACTACAGCGC
CAAGTTTTTCCTGCGTCCGCACTTCCAACTGGAAGGCCTGACCGTCTCGCTGCGCTTGGTGGCGCGACTG
CCGTCGGTTAAGGAAGCTGCGTAA
 Primer design