SecReT6
Protein ID: 241663278
SecReT6 ID349
T6SS typei3
Gene symbol-
Locus tagRpic12D_1683
StrainRalstonia pickettii 12D
Repliconchromosome I [GenBank: NC_012856] [Browse all T6SS(s) in this replicon]
Location [Strand]1790070..1790609 [-]
Producttype VI secretion protein
NoteTssB
UniProt IDC6BJ43
KEGG IDrpf:Rpic12D_1683
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 4.30E-61, Aligned region: 11..164
Protein Sequence: 179 a.a.     [Download]
>gi|241663278|ref|YP_002981638.1| type VI secretion protein [Ralstonia pickettii 12D]
MSVVNSSQKFIARNRAPRVQIEYDVEVYGSEKRIELPFVMGVLADLSGKPAEPLPSVADRKFLEIDIDNF
DERMKAMKPRVAFAVQNTLTGEGQLMVDMTFESIEDFSPAAVAGKVDALKQLLEARTQLANLQTYMDGKS
GAESLINQLLQDPALLQALAKAPKPEVTPVQAGTEQTDA
 
Nucleotide Sequence: 540 bp     [Download]
>gi|241661625|ref|NC_012856.1|:c1790609-1790070 Ralstonia pickettii 12D chromosome 1, complete sequence
ATGTCTGTTGTGAACAGTTCGCAGAAATTCATCGCGCGCAACCGCGCACCGCGCGTCCAGATCGAGTACG
ACGTCGAAGTCTACGGCTCGGAGAAACGGATCGAGTTGCCTTTCGTGATGGGCGTGTTGGCCGACCTGTC
CGGGAAGCCGGCTGAGCCGCTGCCTTCGGTGGCCGATCGCAAGTTCCTCGAAATAGATATCGACAACTTC
GACGAGCGCATGAAAGCCATGAAGCCGCGCGTTGCGTTTGCTGTGCAGAACACGCTCACCGGCGAAGGCC
AACTGATGGTCGACATGACCTTCGAGAGCATTGAAGACTTCTCGCCCGCCGCGGTCGCCGGCAAGGTAGA
CGCGCTTAAGCAACTGCTCGAAGCCCGGACGCAGCTGGCCAACCTGCAGACCTACATGGACGGCAAGTCC
GGCGCCGAGTCGCTCATCAACCAACTGCTGCAAGACCCGGCCCTGCTGCAAGCACTGGCCAAGGCACCGA
AGCCCGAGGTGACGCCGGTTCAAGCCGGGACCGAGCAGACCGACGCCTGA
 Primer design