SecReT6
Protein ID: 241663279
SecReT6 ID349
T6SS typei3
Gene symbol-
Locus tagRpic12D_1684
StrainRalstonia pickettii 12D
Repliconchromosome I [GenBank: NC_012856] [Browse all T6SS(s) in this replicon]
Location [Strand]1790661..1793357 [-]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDC6BJ44
KEGG IDrpf:Rpic12D_1684
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 8.00E-39, Aligned region: 231..311
AAA_2 [PF07724], Evalue: 8.00E-39, Aligned region: 611..777
AAA [PF00004], Evalue: 2.00E-23, Aligned region: 182..193
AAA [PF00004], Evalue: 2.00E-23, Aligned region: 233..365
AAA [PF00004], Evalue: 2.00E-23, Aligned region: 380..399
AAA [PF00004], Evalue: 2.00E-23, Aligned region: 617..701
AAA_5 [PF07728], Evalue: 9.50E-16, Aligned region: 183..200
AAA_5 [PF07728], Evalue: 9.50E-16, Aligned region: 233..311
AAA_5 [PF07728], Evalue: 9.50E-16, Aligned region: 381..402
AAA_5 [PF07728], Evalue: 9.50E-16, Aligned region: 616..726
ClpB_D2-small [PF10431], Evalue: 6.50E-15, Aligned region: 467..505
ClpB_D2-small [PF10431], Evalue: 6.50E-15, Aligned region: 784..854
AAA_16 [PF13191], Evalue: 3.20E-12, Aligned region: 32..75
AAA_16 [PF13191], Evalue: 3.20E-12, Aligned region: 183..200
AAA_16 [PF13191], Evalue: 3.20E-12, Aligned region: 210..253
AAA_16 [PF13191], Evalue: 3.20E-12, Aligned region: 271..312
AAA_16 [PF13191], Evalue: 3.20E-12, Aligned region: 338..402
AAA_16 [PF13191], Evalue: 3.20E-12, Aligned region: 587..657
AAA_16 [PF13191], Evalue: 3.20E-12, Aligned region: 716..716
AAA_22 [PF13401], Evalue: 1.90E-10, Aligned region: 183..198
AAA_22 [PF13401], Evalue: 1.90E-10, Aligned region: 233..313
AAA_22 [PF13401], Evalue: 1.90E-10, Aligned region: 373..402
AAA_22 [PF13401], Evalue: 1.90E-10, Aligned region: 615..639
AAA_22 [PF13401], Evalue: 1.90E-10, Aligned region: 678..697
Sigma54_activat [PF00158], Evalue: 2.10E-08, Aligned region: 183..200
Sigma54_activat [PF00158], Evalue: 2.10E-08, Aligned region: 228..313
Sigma54_activat [PF00158], Evalue: 2.10E-08, Aligned region: 586..720
AAA_14 [PF13173], Evalue: 4.40E-06, Aligned region: 233..313
AAA_14 [PF13173], Evalue: 4.40E-06, Aligned region: 363..400
AAA_14 [PF13173], Evalue: 4.40E-06, Aligned region: 615..708
NACHT [PF05729], Evalue: 5.00E-06, Aligned region: 184..193
NACHT [PF05729], Evalue: 5.00E-06, Aligned region: 233..260
NACHT [PF05729], Evalue: 5.00E-06, Aligned region: 293..340
NACHT [PF05729], Evalue: 5.00E-06, Aligned region: 616..645
AAA_17 [PF13207], Evalue: 6.20E-06, Aligned region: 183..193
AAA_17 [PF13207], Evalue: 6.20E-06, Aligned region: 233..275
AAA_17 [PF13207], Evalue: 6.20E-06, Aligned region: 615..651
Clp_N [PF02861], Evalue: 9.20E-06, Aligned region: 27..74
IstB_IS21 [PF01695], Evalue: 1.10E-05, Aligned region: 183..192
IstB_IS21 [PF01695], Evalue: 1.10E-05, Aligned region: 221..252
IstB_IS21 [PF01695], Evalue: 1.10E-05, Aligned region: 616..636
RNA_helicase [PF00910], Evalue: 1.50E-05, Aligned region: 182..211
RNA_helicase [PF00910], Evalue: 1.50E-05, Aligned region: 234..254
RNA_helicase [PF00910], Evalue: 1.50E-05, Aligned region: 617..638
Zeta_toxin [PF06414], Evalue: 3.00E-05, Aligned region: 232..253
Zeta_toxin [PF06414], Evalue: 3.00E-05, Aligned region: 483..534
Zeta_toxin [PF06414], Evalue: 3.00E-05, Aligned region: 606..656
AAA_29 [PF13555], Evalue: 3.20E-05, Aligned region: 183..191
AAA_29 [PF13555], Evalue: 3.20E-05, Aligned region: 223..250
AAA_29 [PF13555], Evalue: 3.20E-05, Aligned region: 614..641
AAA_18 [PF13238], Evalue: 4.40E-05, Aligned region: 183..195
AAA_18 [PF13238], Evalue: 4.40E-05, Aligned region: 233..267
AAA_18 [PF13238], Evalue: 4.40E-05, Aligned region: 617..646
AAA_25 [PF13481], Evalue: 5.80E-05, Aligned region: 173..193
AAA_25 [PF13481], Evalue: 5.80E-05, Aligned region: 233..257
AAA_25 [PF13481], Evalue: 5.80E-05, Aligned region: 612..642
Arch_ATPase [PF01637], Evalue: 0.00011, Aligned region: 212..249
Arch_ATPase [PF01637], Evalue: 0.00011, Aligned region: 286..316
Arch_ATPase [PF01637], Evalue: 0.00011, Aligned region: 376..407
Arch_ATPase [PF01637], Evalue: 0.00011, Aligned region: 615..630
AAA_19 [PF13245], Evalue: 0.00017, Aligned region: 183..199
AAA_19 [PF13245], Evalue: 0.00017, Aligned region: 231..254
AAA_19 [PF13245], Evalue: 0.00017, Aligned region: 613..638
RuvB_N [PF05496], Evalue: 0.00079, Aligned region: 231..253
RuvB_N [PF05496], Evalue: 0.00079, Aligned region: 303..313
RuvB_N [PF05496], Evalue: 0.00079, Aligned region: 577..637
RuvB_N [PF05496], Evalue: 0.00079, Aligned region: 685..710
AAA_30 [PF13604], Evalue: 0.0033, Aligned region: 178..202
AAA_30 [PF13604], Evalue: 0.0033, Aligned region: 232..255
AAA_30 [PF13604], Evalue: 0.0033, Aligned region: 614..645
DUF258 [PF03193], Evalue: 0.0035, Aligned region: 172..194
DUF258 [PF03193], Evalue: 0.0035, Aligned region: 220..252
DUF258 [PF03193], Evalue: 0.0035, Aligned region: 615..628
MobB [PF03205], Evalue: 0.0071, Aligned region: 180..194
MobB [PF03205], Evalue: 0.0071, Aligned region: 234..263
MobB [PF03205], Evalue: 0.0071, Aligned region: 615..637
SRP54 [PF00448], Evalue: 0.0075, Aligned region: 232..253
SRP54 [PF00448], Evalue: 0.0075, Aligned region: 615..639
Hpr_kinase_C [PF07475], Evalue: 0.0077, Aligned region: 233..244
Hpr_kinase_C [PF07475], Evalue: 0.0077, Aligned region: 613..633
Protein Sequence: 898 a.a.     [Download]
>gi|241663279|ref|YP_002981639.1| type VI secretion ATPase, ClpV1 family [Ralstonia pickettii 12D]
MEISRQALFGRLNPSLFKAIESATAFCKLRGNPYVELVHWLHQLLRASDGDLQRVLRHAEVDLQALEADL
ARALASLPTGASSISDFSFQIEAAVERAWVYATLAFADDRVRGAYLLTALLKTTELRRTVLSISSQFAKV
RADDLVDSIPGLIAQSPESQEAAYDGSGLASAIPGEASGAVSPTGTGKSALAQYCRDLTEAAREGQLDPV
IGREHEIRTMTDILLRRRQNNPLLTGEAGVGKTAVIEGLAQAIAVGDIPPSLKDVRLLSLDVGALLAGAS
MKGEFEARLKGVLEEAAKSAKPVILFVDEVHTLVGAGGQAGTGDAANLLKPALARGALRTIGATTWSEYK
RHIEKDPALTRRFQVLQVLEPQEASAVAMVRGLVDTFETHHKVLILDEAVRAAVKLSHRYIPSRQLPDKA
ISLLDTACARVALTLHAPPAAVELARQRLAAAQADSALLAKEAAFGKEDRRRIAEIDSAICEITTELAQA
EARWQQERALATSILEQRQAIEAAAEETSQSPAALIDLEAELQSVQGETPLVYTEVGEAVVAAIVADWTG
IPVTRMVADEVATVMALPQTLGARIIGQDHALAQLGERIQTARAQLTDPNKPVGVFLLVGPSGVGKTETA
LALADALYGGEQNLITINLSEFQESHTVSTLKGAPPGYVGYGEGGVLTEAVRRRPYSVVLLDEVEKAHPD
VHEVFYQVFDKGYMEDGEGRHIDFKNTILLLTSNAGSDLLTSLCDDLALLPEPAALRDALMPELRKTFPA
AFLGRLVVVPYLPLAADNLGRIVHRHLDRVVKRMREQHDIALTYDDAVVTHIVERCPVGETGARQLIGLI
EQVIQPQLAKLWLGALADKRPLAAIEIRMADDASTLIYHPEYLTGRSAGPAIPTAEPV
 
Nucleotide Sequence: 2697 bp     [Download]
>gi|241661625|ref|NC_012856.1|:c1793357-1790661 Ralstonia pickettii 12D chromosome 1, complete sequence
ATGGAAATTTCACGTCAGGCGCTATTTGGCCGACTCAATCCGAGTCTTTTCAAGGCAATCGAAAGCGCGA
CCGCCTTCTGCAAGCTCCGTGGCAACCCATACGTCGAACTCGTGCACTGGTTGCATCAGCTACTGCGAGC
ATCCGATGGCGACCTGCAGCGCGTGCTGAGGCATGCCGAAGTCGACTTGCAGGCACTTGAGGCTGATCTT
GCGCGTGCACTAGCTTCGCTCCCGACTGGCGCCAGTTCCATCAGCGATTTCTCCTTCCAGATCGAAGCTG
CCGTCGAGCGCGCCTGGGTGTATGCCACGCTTGCTTTTGCCGATGATCGCGTGCGCGGTGCGTACCTCCT
GACGGCACTGCTCAAGACGACGGAGCTGCGCCGCACTGTGCTCAGTATCTCCAGCCAGTTCGCCAAGGTC
CGTGCGGATGATCTGGTCGACAGCATCCCGGGACTGATTGCGCAATCTCCCGAGAGTCAGGAAGCGGCCT
ACGATGGTAGTGGTCTCGCATCCGCCATTCCGGGCGAAGCGAGTGGAGCGGTTAGCCCTACCGGTACGGG
CAAGAGCGCACTCGCCCAATATTGCCGCGACCTAACAGAAGCCGCACGGGAAGGGCAGCTTGATCCCGTC
ATCGGTCGCGAGCACGAAATCCGCACCATGACGGACATCCTGCTGCGCCGTCGCCAGAATAACCCGTTGC
TGACCGGTGAGGCCGGCGTTGGCAAAACGGCCGTGATCGAAGGCCTGGCCCAGGCTATCGCCGTGGGCGA
CATTCCCCCGAGTCTCAAAGACGTCCGTCTGCTCAGCCTAGACGTTGGTGCACTGCTGGCGGGCGCCAGC
ATGAAGGGCGAGTTCGAAGCCCGCTTGAAGGGCGTGCTGGAAGAGGCCGCCAAGTCGGCCAAGCCCGTCA
TCCTGTTTGTTGACGAAGTGCATACCCTCGTCGGCGCAGGCGGCCAAGCCGGCACGGGTGACGCCGCCAA
CCTACTCAAGCCCGCACTCGCCCGCGGGGCCCTGCGCACGATCGGCGCGACTACGTGGAGCGAGTACAAG
CGCCACATCGAAAAAGACCCCGCGCTCACCCGCCGCTTCCAAGTCCTGCAAGTCTTGGAGCCGCAAGAAG
CCAGCGCCGTCGCCATGGTGCGCGGTCTGGTAGACACCTTCGAGACCCACCACAAGGTCCTGATCCTTGA
CGAAGCCGTACGTGCCGCCGTCAAGCTCTCGCACCGCTACATCCCCTCGCGCCAGTTGCCCGACAAGGCC
ATCAGCCTGTTGGATACGGCATGCGCGCGTGTTGCCTTGACGCTGCACGCACCGCCTGCTGCCGTGGAGT
TGGCGCGCCAGCGTCTGGCTGCGGCCCAAGCCGACTCGGCCTTGCTTGCCAAGGAAGCTGCGTTCGGTAA
GGAAGATCGTCGCCGTATTGCCGAGATTGACAGCGCGATCTGCGAGATCACGACCGAACTTGCCCAAGCC
GAAGCCCGCTGGCAGCAGGAGAGGGCACTCGCCACCAGCATTCTTGAACAGCGGCAGGCCATCGAAGCTG
CGGCGGAAGAGACGAGCCAATCGCCAGCCGCACTGATCGACCTCGAAGCCGAGTTGCAGTCCGTCCAAGG
CGAGACACCGTTGGTGTACACCGAGGTGGGTGAAGCCGTGGTGGCTGCCATCGTGGCTGACTGGACTGGC
ATCCCCGTCACCCGCATGGTGGCTGATGAAGTCGCCACCGTGATGGCCCTACCGCAAACACTGGGTGCAC
GCATCATCGGCCAGGACCACGCGCTTGCGCAGCTTGGCGAGCGTATCCAGACCGCCCGTGCCCAGCTGAC
CGACCCCAACAAGCCCGTCGGCGTGTTCCTGCTGGTGGGCCCCTCCGGTGTCGGCAAGACCGAAACCGCA
TTGGCGCTGGCCGACGCGCTCTACGGTGGCGAGCAAAACCTCATCACCATCAACCTCTCCGAATTCCAGG
AGTCGCACACCGTATCCACGCTCAAGGGTGCGCCGCCGGGCTATGTCGGCTATGGCGAGGGTGGGGTACT
GACCGAAGCCGTCCGCCGCCGTCCCTACAGCGTCGTGCTGCTCGACGAGGTGGAAAAGGCTCACCCAGAC
GTGCATGAAGTCTTCTACCAAGTCTTCGACAAAGGCTATATGGAAGATGGGGAAGGGCGCCACATTGACT
TCAAGAACACCATTCTCCTGCTGACGAGCAACGCCGGTTCCGACCTGCTGACCAGCTTGTGCGACGACCT
CGCGCTGTTGCCGGAGCCGGCGGCACTGCGCGATGCGCTCATGCCCGAGCTGCGCAAGACGTTCCCCGCC
GCATTCCTCGGTCGCCTAGTGGTGGTGCCATACCTGCCGTTGGCCGCCGACAACCTCGGCCGCATCGTCC
ACCGGCACCTAGACCGCGTGGTCAAGCGCATGCGTGAGCAGCACGACATCGCGCTCACCTATGACGACGC
CGTGGTGACGCACATCGTTGAGCGCTGCCCGGTCGGCGAAACCGGTGCACGCCAGTTGATCGGCTTGATC
GAGCAAGTTATCCAGCCGCAACTGGCCAAGCTCTGGCTGGGCGCGCTGGCCGACAAGCGTCCTCTCGCCG
CCATTGAAATCCGTATGGCCGACGACGCATCCACATTGATCTACCACCCCGAATACCTGACCGGCCGCAG
CGCAGGGCCGGCCATTCCCACCGCCGAACCGGTCTGA
 Primer design