SecReT6
Protein ID: 241663281
SecReT6 ID349
T6SS typei3
Gene symbol-
Locus tagRpic12D_1686
StrainRalstonia pickettii 12D
Repliconchromosome I [GenBank: NC_012856] [Browse all T6SS(s) in this replicon]
Location [Strand]1794391..1795218 [+]
Productvirulence protein SciE type
NoteTagJ
UniProt IDC6BJ46
KEGG IDrpf:Rpic12D_1686
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 8.20E-48, Aligned region: 152..271
Protein Sequence: 275 a.a.     [Download]
>gi|241663281|ref|YP_002981641.1| virulence protein SciE type [Ralstonia pickettii 12D]
MTTDALLMDTPSTSGLVAVLQHSGSVAQALQNAEVRVRQQPGAFEERWHLFQWLCMTGDWERALKQLQVA
TQLTPDFAQTAHAYRSLIRAEMFRQGVFNGEREPGALLSPPAWMEPLHKALAQAASGDIEEADHSRHLAL
VDATTASGAHNAGTFAWISDSDTRLGPTCEIISAGRYAWLPFAQMRRLEMGAVVGLLDLIWRPATVMLAD
GVVCRGFVPVRYPGSEDGDDATRLARKTNWTEVGETGVLGWGQKTWVTDGGDIGMLNITSLVLGR
 
Nucleotide Sequence: 828 bp     [Download]
>gi|241661625|ref|NC_012856.1|:1794391-1795218 Ralstonia pickettii 12D chromosome 1, complete sequence
ATGACCACTGATGCCTTGCTTATGGATACGCCTTCGACATCAGGTCTGGTGGCCGTTCTGCAGCACAGTG
GTTCGGTTGCGCAAGCGCTGCAGAACGCTGAAGTGCGCGTGCGTCAGCAACCGGGCGCGTTTGAAGAACG
CTGGCATCTCTTTCAATGGTTGTGCATGACGGGCGACTGGGAGCGCGCGCTCAAGCAATTGCAGGTCGCA
ACTCAACTGACGCCAGACTTTGCGCAAACGGCCCACGCCTATCGCAGCCTGATTCGGGCGGAGATGTTTC
GTCAGGGCGTGTTCAATGGAGAGCGCGAACCCGGTGCACTGCTGAGCCCGCCGGCCTGGATGGAGCCGTT
GCACAAGGCATTGGCACAAGCGGCATCAGGAGACATTGAAGAAGCGGACCATAGCCGACACCTTGCCCTC
GTAGACGCAACTACGGCATCCGGCGCACACAATGCGGGCACCTTTGCCTGGATCAGCGATAGCGATACGC
GTCTTGGTCCCACCTGCGAAATCATCTCGGCGGGGCGCTACGCATGGCTGCCGTTCGCACAGATGCGCCG
GCTGGAGATGGGTGCAGTTGTTGGTTTGCTCGACCTGATCTGGCGCCCCGCTACCGTAATGCTGGCCGAT
GGCGTGGTGTGCCGCGGCTTCGTGCCTGTGCGCTACCCGGGCTCCGAGGACGGTGATGATGCAACCCGGC
TGGCGCGCAAGACCAACTGGACCGAGGTGGGCGAGACCGGTGTGCTGGGATGGGGTCAGAAGACGTGGGT
GACCGACGGAGGTGATATTGGCATGCTCAATATCACGTCACTGGTGCTGGGACGCTGA
 Primer design