SecReT6
Protein ID: 241663284
SecReT6 ID349
T6SS typei3
Gene symbol-
Locus tagRpic12D_1689
StrainRalstonia pickettii 12D
Repliconchromosome I [GenBank: NC_012856] [Browse all T6SS(s) in this replicon]
Location [Strand]1799230..1799751 [+]
Producttype VI secretion system lysozyme-like protein
NoteTssE
UniProt IDC6BJ49
KEGG IDrpf:Rpic12D_1689
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.50E-18, Aligned region: 39..150
Protein Sequence: 173 a.a.     [Download]
>gi|241663284|ref|YP_002981644.1| type VI secretion system lysozyme-like protein [Ralstonia pickettii 12D]
MSEHRPPIRPNAQLLPTLFDRLRDAAPQRQTEAANEYTVTRTQMREILQRDLTYLLNTTNREDEIDRTRY
PEAASSTINYGVPPVAGSYLSEHKWTDIVKIVRRAILDFEPRLIPGSLEVKPLLKEDAPTRYNVLLFEIS
GLIHMDPYPMAFTAQSSLDLETGHMNVRSLHAH
 
Nucleotide Sequence: 522 bp     [Download]
>gi|241661625|ref|NC_012856.1|:1799230-1799751 Ralstonia pickettii 12D chromosome 1, complete sequence
ATGTCTGAACATCGCCCTCCCATCCGCCCCAACGCACAACTGCTGCCGACACTCTTTGACCGGTTGCGCG
ACGCTGCACCACAGCGGCAAACGGAAGCCGCCAACGAATACACGGTCACGCGCACGCAGATGCGCGAGAT
CCTCCAGCGCGATCTGACGTACCTGCTCAACACCACGAATCGCGAAGACGAGATCGATCGGACACGCTAC
CCAGAGGCGGCAAGTTCCACCATCAACTATGGGGTACCGCCGGTGGCCGGCAGCTATCTGTCGGAACACA
AGTGGACCGACATCGTCAAGATCGTGCGCCGCGCGATTCTGGATTTCGAGCCACGGCTCATTCCTGGCTC
GCTGGAAGTCAAGCCGTTGCTCAAGGAAGACGCGCCAACTCGCTACAACGTGCTGCTGTTCGAGATCAGC
GGGCTGATCCACATGGACCCGTACCCGATGGCCTTTACCGCGCAGAGCTCGCTCGATCTGGAAACTGGCC
ACATGAACGTTCGCTCACTTCACGCCCACTGA
 Primer design