SecReT6
Protein ID: 241663285
SecReT6 ID349
T6SS typei3
Gene symbol-
Locus tagRpic12D_1690
StrainRalstonia pickettii 12D
Repliconchromosome I [GenBank: NC_012856] [Browse all T6SS(s) in this replicon]
Location [Strand]1799756..1801636 [+]
Producttype VI secretion protein
NoteTssF
UniProt IDC6BJ50
KEGG IDrpf:Rpic12D_1690
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 5.10E-213, Aligned region: 5..626
Protein Sequence: 626 a.a.     [Download]
>gi|241663285|ref|YP_002981645.1| type VI secretion protein [Ralstonia pickettii 12D]
MDPQLLDYYNRELVYMRELAGEFARQHPKVAKRLGMHGIEVADPYVERLIEAFCLLSARTQIKLDAEFPR
FTQRLLEVVYPNYVAPTPAIAVAQFHPSRTEGDLVRGVPIPRDTALLAKAPPGESTECEFRTTQPLTLRP
IEIAEARLTGIPPDIQGLERYVPAQVSVQGALRLRLRLTHDVKFSQLAGLDRLPIYLSGNDQIASHLFEL
LHSAGCATLIGKPGAMGERPTAVTDNAVSHVGMAPDEGAFPLAWNKFHGHNLVHEYFACPQRFYFFGLNG
LARGLSKNDGREAEIVVLLSKAPSALVSQVDASQFALFCTPVINLFPMRTDRMEVSPGRTEFHLVADRRR
PLDFEVFSVQKLSGQVNEHSTPIDFRPLFATLNSDEGNHGRYFSARREPRLFSDQARKYGTRTAYTGTEV
FLSLVDQNEAPYPNDLRYLSVEAMVTNRDLPNLVPRNGFSDLSSPASIPVEGVGLIRPPSAPHAPFAEGE
MAWRLIRQLGFNYLSLMDLDHRQGGQGLRDMLRLFVSASDTAQQRQIESLIGSKLKPVTRRMPGAGPILY
GRGVQCQLTVDEAGFSGVSPYLFGVVLEHFLARHVSVNAFTETELHAMERGLIHRWSPRMGGRNVI
 
Nucleotide Sequence: 1881 bp     [Download]
>gi|241661625|ref|NC_012856.1|:1799756-1801636 Ralstonia pickettii 12D chromosome 1, complete sequence
ATGGACCCGCAACTGCTGGATTACTACAACCGGGAACTGGTCTACATGCGAGAGCTGGCCGGTGAATTCG
CCCGGCAGCACCCGAAGGTGGCCAAGCGCCTTGGCATGCACGGCATCGAGGTGGCGGACCCATATGTGGA
ACGCCTGATCGAGGCGTTCTGCCTGTTGTCGGCACGCACCCAGATCAAGCTGGATGCGGAGTTCCCGCGC
TTCACGCAACGGTTGCTGGAGGTGGTCTACCCGAACTACGTAGCGCCGACGCCGGCCATTGCGGTGGCGC
AGTTCCACCCTAGCCGCACCGAAGGCGATCTAGTGCGCGGGGTTCCGATACCGCGGGACACGGCTTTGCT
CGCAAAGGCACCACCTGGCGAATCCACCGAGTGTGAATTCCGCACCACCCAACCGCTGACATTGCGGCCA
ATCGAGATTGCGGAAGCGCGACTCACAGGCATTCCACCGGACATTCAGGGCTTGGAGCGCTACGTGCCGG
CTCAGGTGAGCGTCCAAGGCGCACTGCGCCTGCGGTTACGGCTCACACACGATGTCAAGTTCAGCCAGTT
GGCCGGTCTGGATCGCCTGCCCATCTACCTGAGTGGCAATGATCAGATTGCGTCGCACTTGTTCGAGCTG
CTTCACAGCGCAGGCTGCGCGACACTCATTGGCAAGCCCGGCGCTATGGGTGAACGTCCAACCGCCGTCA
CGGACAACGCCGTCAGTCATGTCGGTATGGCACCCGACGAAGGCGCGTTTCCATTGGCCTGGAACAAGTT
CCACGGACACAACCTCGTGCATGAGTACTTTGCGTGCCCGCAGCGCTTTTACTTCTTTGGGCTCAATGGG
CTTGCGCGCGGGCTCTCCAAGAATGATGGCCGCGAAGCGGAGATTGTGGTGCTGCTCTCCAAAGCGCCGA
GTGCTCTGGTCAGCCAGGTCGATGCCAGCCAGTTCGCGCTGTTCTGCACACCGGTCATCAACCTCTTCCC
GATGCGAACCGATCGGATGGAGGTGAGCCCGGGCCGTACGGAATTCCACCTGGTGGCCGACCGGAGGCGC
CCGCTTGATTTCGAGGTGTTCTCGGTACAGAAGCTCTCGGGCCAAGTGAACGAGCACAGTACGCCGATCG
ACTTCCGGCCGCTGTTTGCCACGCTCAACAGCGATGAGGGCAACCATGGCCGGTACTTCTCTGCGCGACG
GGAGCCGCGGCTGTTCTCGGATCAGGCACGCAAGTACGGCACCCGCACGGCCTATACGGGCACGGAGGTG
TTTCTCTCGCTGGTGGACCAGAACGAAGCGCCCTACCCGAACGACCTGCGTTATCTGTCGGTCGAGGCAA
TGGTGACCAATCGGGATTTGCCGAATCTGGTGCCGCGCAATGGATTCAGTGATCTGAGCTCACCCGCTTC
GATTCCGGTGGAAGGGGTTGGGTTGATCCGTCCGCCATCGGCACCACATGCACCGTTTGCTGAAGGGGAG
ATGGCCTGGCGGCTGATACGCCAGTTGGGCTTCAACTACCTGTCGCTGATGGATCTCGACCATCGACAGG
GTGGCCAGGGGCTGCGCGACATGCTTCGGCTGTTTGTGTCGGCCAGCGATACCGCCCAGCAGCGGCAGAT
CGAGAGCCTGATCGGTTCCAAGCTCAAGCCCGTCACACGGCGCATGCCGGGGGCGGGTCCGATTCTGTAC
GGCCGTGGCGTGCAGTGTCAGTTGACGGTGGATGAGGCCGGCTTCTCTGGCGTCAGCCCGTACCTGTTTG
GCGTGGTGCTGGAACACTTCTTGGCTCGCCATGTGTCGGTCAACGCTTTCACGGAAACCGAGCTGCACGC
GATGGAACGCGGTCTGATTCACCGATGGTCGCCCCGTATGGGTGGCCGCAATGTCATTTAG
 Primer design