SecReT6
Protein ID: 241663286
SecReT6 ID349
T6SS typei3
Gene symbol-
Locus tagRpic12D_1691
StrainRalstonia pickettii 12D
Repliconchromosome I [GenBank: NC_012856] [Browse all T6SS(s) in this replicon]
Location [Strand]1801639..1802679 [+]
Producttype VI secretion protein
NoteTssG
UniProt IDC6BJ51
KEGG IDrpf:Rpic12D_1691
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 4.20E-97, Aligned region: 26..326
Protein Sequence: 346 a.a.     [Download]
>gi|241663286|ref|YP_002981646.1| type VI secretion protein [Ralstonia pickettii 12D]
MFHGRDDLGPPPAPTRHTHRHYADLQPWKLSFLGLLRGLSARHATLPRVGRAPRPQAEPFRIGQVASLTF
APREIAKLEQRADRLRIQLFGLGMLGPNGALPIHLTEIVRERTEAHHDNTTAAFLDIFHHRSLTQFYQAW
AGSQAAAGLDRRDEEVFSRYIGWLAGAEADEISGSALPPHARLAASAHHVRESRSPDGIVAALSHFFGVP
VQLQEFVLHWIAVDAAECSHLGRPGAASMMGQGALLGEAVPDRQHKFRLIIGPLDLQKYLNFTPKGRDLP
VLVEWVRSFVSFEFEWEVELQVQPHSAPPAVLGAQERLGWSTWLGQPDSSRAITGMVFQPEHYVAQ
 
Nucleotide Sequence: 1041 bp     [Download]
>gi|241661625|ref|NC_012856.1|:1801639-1802679 Ralstonia pickettii 12D chromosome 1, complete sequence
ATGTTCCACGGTCGAGATGATCTTGGGCCTCCGCCCGCGCCCACGCGGCACACCCACCGTCACTATGCTG
ATCTGCAGCCCTGGAAGCTGAGCTTTCTTGGGCTGTTGCGGGGGTTGTCTGCGCGCCATGCCACGCTGCC
CCGGGTTGGCCGCGCACCCCGCCCGCAGGCGGAGCCCTTCCGCATCGGGCAAGTGGCTTCACTCACCTTT
GCGCCACGCGAGATTGCGAAGCTGGAGCAGCGCGCCGATCGTCTGCGTATCCAATTGTTCGGCTTGGGCA
TGTTGGGCCCCAATGGCGCGCTACCGATCCACCTGACGGAAATCGTTCGGGAACGCACCGAAGCGCACCA
TGACAACACCACAGCCGCGTTTCTGGATATCTTCCACCATCGGTCGCTAACGCAGTTCTATCAGGCTTGG
GCGGGTTCACAGGCTGCCGCTGGACTCGACCGGCGTGACGAGGAGGTGTTTTCGCGCTACATCGGCTGGC
TGGCGGGGGCCGAGGCCGATGAAATTTCCGGCAGCGCGCTGCCGCCACATGCACGGCTGGCTGCTAGTGC
CCATCATGTGCGCGAATCGCGTAGCCCAGACGGCATCGTGGCGGCGCTGTCGCACTTCTTTGGGGTGCCG
GTGCAGTTACAGGAGTTTGTGCTGCATTGGATCGCCGTGGATGCTGCCGAGTGCAGCCACCTGGGCCGCC
CAGGCGCGGCCAGCATGATGGGGCAAGGCGCCTTGCTCGGCGAGGCGGTGCCCGATCGCCAGCACAAGTT
CCGGCTCATCATCGGGCCGCTCGATCTGCAGAAGTACCTGAACTTCACCCCGAAGGGGCGTGATCTGCCG
GTGCTGGTGGAGTGGGTGCGCAGCTTTGTCAGCTTTGAGTTTGAGTGGGAAGTCGAGTTGCAGGTGCAAC
CGCATTCCGCGCCGCCGGCGGTGCTGGGCGCCCAGGAGCGGCTGGGCTGGTCGACCTGGCTTGGTCAACC
GGACAGTAGCCGTGCCATTACAGGCATGGTTTTCCAACCTGAACACTATGTTGCTCAATAA
 Primer design