SecReT6
Protein ID: 241663287
SecReT6 ID349
T6SS typei3
Gene symbol-
Locus tagRpic12D_1692
StrainRalstonia pickettii 12D
Repliconchromosome I [GenBank: NC_012856] [Browse all T6SS(s) in this replicon]
Location [Strand]1802666..1803748 [+]
Producttype VI secretion-associated protein, ImpA family
NoteTssA
UniProt IDC6BJ52
KEGG IDrpf:Rpic12D_1692
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.10E-19, Aligned region: 71..130
Protein Sequence: 360 a.a.     [Download]
>gi|241663287|ref|YP_002981647.1| type VI secretion-associated protein, ImpA family [Ralstonia pickettii 12D]
MLLNKLMKAVAPQYASSPDIRFADLALPVSADQPCGPDLEYDTDFVVLQARATQCEAAQYGDFVAPTEVL
NWPELERDCQRLLLRTKDIRLLTLFLRCRTRLDQAEGLRDGLALMHTVLTAFPEQVHPRLEIDGDVDPGV
RANALATLVDPQGLLADVREIALGNNAMRLQIRDIERALGKSRPADALAPASVHRQLEALHSQGAPEIEA
MQEACALAQSIQLWSETSLPNHAPDLKPLIRLLQLAGRPEPAQPVTIEYAPASEIPPAAAQVPAPSRANN
APLPPADAQHAPSQNANTMPTSRHDALTQICFARTWFEAHEPSSPVALLLRQAESLVGKPFAEVFQAIPA
DIVERWAQNE
 
Nucleotide Sequence: 1083 bp     [Download]
>gi|241661625|ref|NC_012856.1|:1802666-1803748 Ralstonia pickettii 12D chromosome 1, complete sequence
ATGTTGCTCAATAAGCTTATGAAGGCCGTCGCTCCACAATATGCCTCCTCGCCCGACATCCGTTTTGCGG
ATCTGGCGTTACCGGTCAGTGCGGATCAGCCATGTGGTCCTGATCTTGAATACGACACGGACTTTGTGGT
GCTGCAAGCCCGTGCGACCCAGTGTGAGGCGGCCCAGTATGGCGACTTTGTTGCGCCGACCGAGGTGCTG
AATTGGCCTGAACTGGAGCGCGATTGTCAGCGGCTGTTGTTGCGCACCAAGGACATCCGGCTACTGACGC
TTTTTCTGCGATGCCGCACTCGGCTGGACCAAGCCGAGGGCCTGCGCGATGGCCTCGCGCTAATGCATAC
GGTGCTGACGGCCTTCCCCGAGCAAGTCCATCCTCGGCTTGAGATCGACGGGGACGTTGACCCTGGCGTT
CGGGCCAATGCGCTCGCAACGCTGGTCGATCCGCAAGGGCTGTTAGCCGACGTGCGTGAAATTGCCCTGG
GCAACAATGCCATGCGTCTTCAGATACGCGATATCGAGCGTGCGCTGGGCAAGTCACGCCCAGCCGATGC
GCTTGCACCGGCATCAGTGCATCGGCAACTAGAAGCCCTACATAGCCAAGGAGCCCCTGAGATTGAGGCC
ATGCAGGAAGCCTGCGCGCTGGCGCAGTCCATTCAGCTGTGGTCCGAAACTTCACTGCCCAATCACGCGC
CAGATCTAAAGCCGTTGATACGGCTGCTGCAATTGGCCGGGCGTCCTGAGCCGGCACAGCCTGTGACCAT
TGAGTACGCGCCGGCAAGTGAAATACCCCCTGCTGCTGCGCAGGTCCCTGCCCCCTCACGCGCCAACAAT
GCCCCGTTGCCGCCAGCAGACGCGCAACATGCCCCCTCCCAGAATGCCAACACTATGCCAACCAGCCGTC
ACGACGCTCTGACGCAAATCTGCTTCGCACGCACTTGGTTTGAAGCGCACGAGCCAAGCAGTCCGGTCGC
GCTGTTGCTTCGGCAGGCAGAGTCGCTGGTGGGAAAACCGTTTGCGGAGGTATTTCAGGCGATTCCCGCG
GATATCGTTGAAAGGTGGGCGCAGAACGAATAG
 Primer design