SecReT6
Protein ID: 242277894
SecReT6 ID350
T6SS typei1
Gene symbol-
Locus tagDesal_0417
StrainDesulfovibrio salexigens DSM 2638
Repliconchromosome [GenBank: NC_012881] [Browse all T6SS(s) in this replicon]
Location [Strand]449554..451098 [+]
Producttype VI secretion-associated protein
NoteTssA
UniProt IDC6BX04
KEGG IDdsa:Desal_0417
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.70E-21, Aligned region: 47..107
ImpA-rel_N [PF06812], Evalue: 1.70E-21, Aligned region: 310..327
Protein Sequence: 514 a.a.     [Download]
>gi|242277894|ref|YP_002990023.1| type VI secretion-associated protein [Desulfovibrio salexigens DSM 2638]
MELLDLGRKPVSEAKPAGADARYEPEYDLLQQEIDKLASATAGGAVDWKRVVKLGSVILSSKSKDLKVAS
YLAVALLHLKGVEGLSAGAQLLLDLISNFWDTLYPAKKRMRGRFGAISWWDENAEKFLKNYDGDELPKEV
VDLLDKRINDLDAALAEKSEDAPILHDLSSYVQHLPVTAPVEPEQSAPVADESPTVSTPSAPVASADPVV
VNAGNISSPEECSAVLKSGLSVLAPVSEYFLANDLAAAEGYRLRRMIAWTSISALPPAENGRTMIPAPDG
PVKDSIASQLKSADFAGALREAESRIGEYLFWLDLSRMSAEALKGLGENHAAAIAALELETQFYVQRLPA
LASLSFADGTPFADPKTRSWLQSLGSSGAVDSGAESDEVSEIMVKANHLAADKKLFEAVSLICDRINTSP
SLRAAFRLRSGLTGLLTAEGQAGVAHVHAIELLEQIDSSGLAEWEPELALTGLRAAYEAVVAEGGPDSAV
KSIEILQRISRLSPVEALKLNGVN
 
Nucleotide Sequence: 1545 bp     [Download]
>gi|242277482|ref|NC_012881.1|:449554-451098 Desulfovibrio salexigens DSM 2638 chromosome, complete genome
ATGGAACTACTCGATCTGGGCAGGAAACCTGTAAGTGAAGCAAAACCGGCCGGTGCGGATGCCCGTTACG
AACCGGAGTATGACCTTTTGCAGCAGGAAATCGACAAGCTTGCCAGCGCCACAGCGGGCGGTGCGGTGGA
CTGGAAGCGGGTGGTTAAGCTCGGCTCTGTCATCCTGAGCAGCAAATCCAAGGATCTGAAAGTAGCCTCA
TATCTGGCTGTAGCGCTTTTGCATCTCAAGGGTGTGGAAGGTCTTTCGGCAGGGGCGCAACTGCTGCTCG
ATTTGATTTCCAACTTTTGGGATACCCTTTATCCGGCTAAGAAACGCATGCGCGGAAGATTCGGAGCCAT
CAGCTGGTGGGACGAGAATGCCGAGAAATTTTTGAAAAATTATGACGGTGACGAGCTGCCCAAAGAAGTT
GTCGATCTCTTGGATAAGAGGATTAACGATCTTGATGCAGCCTTGGCGGAGAAGTCTGAGGACGCGCCTA
TTCTTCACGATCTGTCCAGTTATGTGCAACATCTTCCCGTGACCGCCCCAGTTGAACCGGAACAGTCTGC
TCCCGTTGCAGATGAGTCTCCAACGGTTTCAACTCCTTCAGCCCCTGTCGCCTCCGCTGATCCTGTTGTG
GTAAATGCGGGTAATATCTCTTCTCCTGAAGAATGCTCTGCCGTACTCAAAAGCGGGCTTTCTGTCCTCG
CTCCTGTTTCTGAATATTTCCTTGCAAATGATCTGGCTGCAGCCGAGGGCTACAGGCTGCGGCGCATGAT
CGCGTGGACGTCCATTTCCGCTCTTCCTCCGGCGGAAAATGGACGGACCATGATCCCTGCACCGGACGGT
CCGGTTAAAGATTCCATTGCCAGTCAGCTTAAGTCTGCTGATTTTGCCGGGGCCTTGCGCGAAGCCGAAT
CCCGTATCGGTGAGTATCTGTTCTGGCTGGACCTAAGCCGCATGTCTGCTGAAGCCCTTAAAGGACTGGG
TGAAAATCACGCCGCAGCGATTGCTGCTCTTGAACTGGAGACACAGTTTTACGTGCAGCGCTTGCCTGCT
TTGGCTTCTTTGAGTTTTGCCGACGGCACTCCTTTTGCCGATCCCAAGACCCGCTCATGGTTGCAGTCCC
TTGGTAGTTCAGGGGCAGTCGATTCCGGTGCTGAGAGCGATGAAGTGTCTGAAATAATGGTTAAAGCCAA
TCATCTTGCTGCGGATAAAAAATTATTCGAGGCAGTTTCCCTAATTTGTGATAGGATCAATACATCTCCC
TCCCTGCGCGCTGCTTTTCGGCTGCGTTCCGGTTTGACCGGACTTCTTACTGCGGAAGGGCAGGCAGGAG
TGGCTCATGTGCACGCAATTGAGTTGCTTGAACAAATTGACAGTTCCGGGCTTGCTGAATGGGAGCCGGA
ACTGGCTTTAACCGGATTGCGGGCAGCCTATGAAGCGGTAGTCGCGGAGGGCGGGCCGGATTCAGCAGTA
AAAAGTATTGAGATTCTACAGCGTATCAGCAGGCTCAGCCCTGTTGAAGCGTTGAAGTTAAACGGTGTTA
ATTAA
 Primer design