SecReT6
Protein ID: 242277895
SecReT6 ID350
T6SS typei1
Gene symbol-
Locus tagDesal_0418
StrainDesulfovibrio salexigens DSM 2638
Repliconchromosome [GenBank: NC_012881] [Browse all T6SS(s) in this replicon]
Location [Strand]451144..451626 [+]
Producttype VI secretion protein
NoteTssB
UniProt IDC6BX05
KEGG IDdsa:Desal_0418
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 7.00E-57, Aligned region: 5..158
Protein Sequence: 160 a.a.     [Download]
>gi|242277895|ref|YP_002990024.1| type VI secretion protein [Desulfovibrio salexigens DSM 2638]
MAKEGSVAPKERVNIVYKPDTGDAKEEVELPLKLLVVGDFTQKDDDRMVEDRDPVNIDKDNFNEVLKAQD
LELNMGVEDKLSGDSDAQMAVKLKFESLKDFDPDRIISQVPELQKLMELREALKALKSPLSNVPEFRKKV
QELVKDDGAREKLLKELGIE
 
Nucleotide Sequence: 483 bp     [Download]
>gi|242277482|ref|NC_012881.1|:451144-451626 Desulfovibrio salexigens DSM 2638 chromosome, complete genome
ATGGCTAAAGAAGGTTCCGTAGCTCCAAAAGAGCGGGTCAATATTGTTTACAAGCCTGATACCGGAGATG
CCAAGGAAGAGGTCGAGCTTCCTCTCAAACTGCTGGTGGTCGGCGATTTTACCCAGAAAGACGATGACCG
CATGGTCGAGGATCGTGATCCGGTAAACATCGACAAGGATAATTTCAACGAAGTTCTCAAGGCTCAGGAT
CTTGAACTGAACATGGGCGTTGAGGACAAGCTTAGCGGTGATTCTGATGCTCAGATGGCGGTCAAGCTCA
AGTTTGAAAGTCTCAAGGACTTTGATCCGGACCGGATCATCAGTCAGGTTCCTGAATTGCAAAAGCTCAT
GGAACTCCGCGAAGCCTTGAAAGCACTGAAGAGTCCGCTCTCCAATGTACCGGAATTCAGGAAAAAGGTT
CAGGAATTGGTCAAGGATGACGGCGCACGCGAAAAGCTGCTTAAAGAACTTGGAATCGAGTAA
 Primer design