SecReT6
Protein ID: 242277896
SecReT6 ID350
T6SS typei1
Gene symbol-
Locus tagDesal_0419
StrainDesulfovibrio salexigens DSM 2638
Repliconchromosome [GenBank: NC_012881] [Browse all T6SS(s) in this replicon]
Location [Strand]451639..453120 [+]
Producttype VI secretion protein EvpB
NoteTssC
UniProt IDC6BX06
KEGG IDdsa:Desal_0419
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.90E-186, Aligned region: 66..491
Protein Sequence: 493 a.a.     [Download]
>gi|242277896|ref|YP_002990025.1| type VI secretion protein EvpB [Desulfovibrio salexigens DSM 2638]
MAEEKLEQQQAEQSTAEVSLLDDIVEATKLKPEDEAYSVTKAGLQAFLEEMVKPERAGAKVSGNLVDDML
AQIDEKLSAQMDSIIHNKEFQKMESSWRSLKFLIDRTDFRENVRIQMMNVSKEDLLDDFDDAPEITKSGL
YKQAYTAEYGQFGGQPFGAIIGNYDFGPGPQDMKLLQYTASVSAMSHAPFIAAAGPEFFGIEKWSELPNL
KDLKSIFEMPQYAKWNSFRESDDSRNVGLTLPKFLLRLPYGPETLPAKSFNYQETVSDGDDDFCWGNTAF
AFASKLTDSFAKYRWCANIIGPQGGGAVEDLPLYQYEAMGAVQTKIPTQVLLSERREFELAEEGFIGLTM
RKGSDNAAFFSANSCQKPKFFGTSKEGKEAELNYKLSTQLPYMMIMDRLAHYIKVIQRENIGTWKERGDL
ERELNTWISQYVTEMDNPAPSVRSRRPLRMAKIEVSDVEGDPGWYQVSLKARPHFKYMGASFTLSLVGKL
EKE
 
Nucleotide Sequence: 1482 bp     [Download]
>gi|242277482|ref|NC_012881.1|:451639-453120 Desulfovibrio salexigens DSM 2638 chromosome, complete genome
ATGGCAGAAGAAAAACTTGAACAACAGCAGGCTGAGCAATCAACAGCCGAAGTTTCGCTTCTTGATGACA
TCGTGGAGGCTACCAAGCTCAAGCCCGAAGACGAAGCTTATTCCGTAACCAAAGCGGGCTTGCAGGCTTT
TCTTGAAGAAATGGTCAAACCTGAGCGCGCGGGAGCCAAAGTTTCCGGCAATCTCGTTGACGACATGCTG
GCCCAGATTGATGAAAAACTTTCTGCGCAGATGGACAGCATCATTCACAACAAGGAATTCCAGAAAATGG
AATCCTCATGGCGGTCGCTCAAGTTTCTGATAGACCGCACGGATTTCCGGGAAAACGTACGTATCCAGAT
GATGAATGTCTCTAAGGAAGACTTGCTGGACGATTTTGATGATGCCCCGGAAATCACCAAATCCGGTCTC
TACAAACAAGCCTATACCGCAGAATACGGTCAGTTCGGTGGTCAGCCCTTCGGAGCCATTATCGGTAACT
ATGATTTCGGGCCCGGACCGCAGGATATGAAACTGCTGCAATACACAGCGTCAGTTTCAGCCATGTCCCA
CGCGCCATTTATTGCCGCAGCGGGACCGGAATTTTTCGGCATTGAAAAATGGAGCGAACTGCCCAATCTC
AAGGATCTTAAATCCATTTTTGAGATGCCGCAGTATGCGAAGTGGAATTCATTCCGTGAATCTGACGATT
CTCGCAATGTCGGGCTGACCCTGCCTAAATTCCTGCTTCGTCTTCCTTACGGTCCGGAAACCCTTCCGGC
CAAGAGCTTCAATTATCAGGAAACCGTCTCGGATGGCGATGATGATTTCTGCTGGGGCAATACTGCGTTC
GCATTTGCTTCCAAGCTGACAGATTCATTCGCCAAGTACCGCTGGTGCGCAAACATCATCGGTCCGCAGG
GCGGCGGGGCTGTGGAAGACCTGCCCCTCTATCAGTATGAGGCCATGGGAGCAGTTCAGACCAAGATTCC
CACACAGGTGCTTCTCTCAGAGCGCAGGGAATTCGAACTTGCCGAGGAAGGTTTCATCGGTCTGACCATG
CGTAAGGGCAGCGATAACGCGGCTTTCTTCTCAGCCAACTCCTGCCAGAAGCCTAAGTTCTTCGGCACCA
GCAAGGAAGGCAAGGAAGCGGAGCTCAACTACAAGCTCTCCACCCAGTTGCCTTATATGATGATCATGGA
CCGTCTGGCTCACTACATTAAAGTTATCCAGCGTGAGAATATCGGCACATGGAAGGAACGTGGCGATCTT
GAGCGCGAACTCAATACGTGGATTTCCCAGTATGTCACCGAGATGGACAATCCTGCTCCAAGTGTGCGCA
GCCGCCGTCCTTTACGTATGGCCAAGATTGAGGTCAGCGATGTGGAAGGCGATCCCGGCTGGTATCAGGT
TTCCCTGAAGGCCCGCCCGCACTTCAAGTACATGGGTGCATCCTTCACCCTTTCATTGGTGGGCAAGCTG
GAGAAGGAATAG
 Primer design