SecReT6
Protein ID: 242277897
SecReT6 ID350
T6SS typei1
Gene symbol-
Locus tagDesal_0420
StrainDesulfovibrio salexigens DSM 2638
Repliconchromosome [GenBank: NC_012881] [Browse all T6SS(s) in this replicon]
Location [Strand]453206..453688 [+]
Producttype VI secretion system effector
NoteTssD
UniProt IDC6BX07
KEGG IDdsa:Desal_0420
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.30E-36, Aligned region: 6..146
Protein Sequence: 160 a.a.     [Download]
>gi|242277897|ref|YP_002990026.1| type VI secretion system effector [Desulfovibrio salexigens DSM 2638]
MALTSYMKVTGKTQGQIKGDCTQTGDKKDTMLIYALDHNVEIPKDTHTGLPTGQRIHKPFTVTKHVDNGS
PKLAQACCKGEQLTVEIDHYHIDPTGIEKKYYTIKMEEAIIVNLHSYKPVTFLPDNKGYHDMEDVSFTYS
KITWTYADGNIEYTDDWKSS
 
Nucleotide Sequence: 483 bp     [Download]
>gi|242277482|ref|NC_012881.1|:453206-453688 Desulfovibrio salexigens DSM 2638 chromosome, complete genome
ATGGCACTTACTTCGTATATGAAAGTAACAGGAAAGACTCAGGGACAGATCAAGGGTGATTGCACCCAGA
CCGGCGATAAAAAAGATACCATGCTTATCTATGCGCTGGATCACAATGTGGAAATCCCCAAAGATACCCA
TACCGGACTGCCCACCGGACAGCGTATCCATAAGCCGTTCACTGTGACCAAACACGTGGACAACGGTTCT
CCGAAACTCGCTCAGGCCTGCTGTAAGGGTGAGCAGCTTACCGTTGAAATTGATCATTATCATATCGATC
CCACCGGAATCGAAAAGAAATATTACACCATCAAGATGGAAGAGGCGATTATCGTCAATCTGCACAGCTA
CAAGCCTGTTACCTTCCTGCCCGACAACAAAGGTTACCATGACATGGAAGATGTCAGCTTTACCTATTCC
AAGATTACTTGGACCTACGCTGACGGCAATATCGAATACACTGACGATTGGAAGTCCAGCTAA
 Primer design