SecReT6
Protein ID: 242277898
SecReT6 ID350
T6SS typei1
Gene symbol-
Locus tagDesal_0421
StrainDesulfovibrio salexigens DSM 2638
Repliconchromosome [GenBank: NC_012881] [Browse all T6SS(s) in this replicon]
Location [Strand]453740..454159 [+]
Producttype VI secretion system lysozyme-like protein
NoteTssE
UniProt IDC6BX08
KEGG IDdsa:Desal_0421
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 6.00E-17, Aligned region: 25..117
Protein Sequence: 139 a.a.     [Download]
>gi|242277898|ref|YP_002990027.1| type VI secretion system lysozyme-like protein [Desulfovibrio salexigens DSM 2638]
MTTQRLLERIRFMEEDPDWRDSADPSQVVKSVLDYLRMILNTRQGNAQIAPDFGVPDFTSMIGATGLDAV
RSIEESMTEVVLKYEPRLANVHIEFVPMEDNPLALHFKLQAKLALEGQDMPVVFETVLDPDGQISVKDN
 
Nucleotide Sequence: 420 bp     [Download]
>gi|242277482|ref|NC_012881.1|:453740-454159 Desulfovibrio salexigens DSM 2638 chromosome, complete genome
TTGACCACTCAGCGACTTCTTGAACGTATCCGTTTTATGGAAGAGGACCCGGATTGGCGCGATTCTGCCG
ATCCGAGTCAGGTGGTCAAGTCTGTGCTCGATTATTTGCGTATGATCCTGAACACCCGTCAGGGTAATGC
CCAGATCGCGCCGGATTTCGGGGTACCGGATTTTACTTCAATGATTGGGGCCACAGGGCTGGATGCAGTG
CGGTCTATTGAAGAATCCATGACCGAGGTTGTTCTCAAGTATGAACCCCGTCTGGCAAACGTACACATCG
AATTCGTTCCCATGGAGGATAACCCGCTGGCTCTGCATTTCAAGTTGCAAGCAAAGCTGGCACTCGAAGG
CCAGGATATGCCCGTAGTGTTCGAGACGGTACTTGATCCGGACGGCCAGATTTCAGTGAAAGATAACTAA
 Primer design