SecReT6
Protein ID: 242277899
SecReT6 ID350
T6SS typei1
Gene symbol-
Locus tagDesal_0422
StrainDesulfovibrio salexigens DSM 2638
Repliconchromosome [GenBank: NC_012881] [Browse all T6SS(s) in this replicon]
Location [Strand]454194..455924 [+]
Producttype VI secretion protein
NoteTssF
UniProt IDC6BX09
KEGG IDdsa:Desal_0422
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 7.10E-182, Aligned region: 3..576
Protein Sequence: 576 a.a.     [Download]
>gi|242277899|ref|YP_002990028.1| type VI secretion protein [Desulfovibrio salexigens DSM 2638]
MIEKYYQRELSHLRELAVEFSKTHPALAPMLTGSGADPDVERLLEGSAFLSGMINQKLDDEFPEIVHGLV
QLVFPHYLRPIPSTTIVKFTPKPSLMESIRVPAGAQIGSIPVSGTSCIFSTTYDVDLHPLSITDVELVKS
AGTSGSLIINLELSGLPLEEWDNSSLRFHLTGDSASASMRYKFLFNYIREIQISGEDGSLCVLGKSNFKA
VGFEDDEALLPYPSQSFPGYRILQEYFILPEKFLFFEITGLDNWRNRGSNGKFKIVLELEKVPQTFDRFT
KDDLCLFATPAINLFKRDAEPVILDHKRPEYQVRPSGDSGGDYQVYSVDNVVGYVQGTVEEKPYKPFHMF
NPQAGEMPVYTVHHRRSPVRDKTDIFVSVAYPAQGEEPVTETLSMALTCTNGTLPEKLRYGDINKPTGTS
PELASFENIRQPTSPVQPPLGRNLLWRLLSHLYLNYLSVADMESLRAMVKLYIFTDTRDRSSVVANTKRV
EAISGMEVSEGDRLVRGLVMRGREIKMSLSCDGFANSGDLYLFSSVMNRFFSGYASVNCFTRLTVEDTLN
KEIYKWTAMIGNRPLL
 
Nucleotide Sequence: 1731 bp     [Download]
>gi|242277482|ref|NC_012881.1|:454194-455924 Desulfovibrio salexigens DSM 2638 chromosome, complete genome
ATGATAGAAAAGTATTATCAGAGGGAACTGAGCCACTTGCGCGAACTGGCGGTGGAATTTTCCAAGACCC
ACCCCGCGCTGGCTCCCATGCTGACCGGATCAGGAGCTGATCCAGACGTGGAACGGCTTCTGGAAGGTTC
GGCTTTTTTGTCCGGCATGATCAACCAGAAGCTGGATGATGAATTTCCTGAGATAGTACACGGTCTGGTG
CAGTTGGTTTTCCCGCATTACTTACGCCCCATCCCTTCAACCACCATAGTAAAATTTACTCCTAAACCTA
GCCTGATGGAAAGCATCCGCGTTCCGGCAGGAGCGCAGATCGGATCAATCCCGGTCAGCGGAACATCATG
CATATTTTCAACAACCTATGATGTTGATTTACATCCTCTTTCCATCACTGATGTGGAGCTGGTCAAAAGC
GCAGGTACCTCCGGTTCTCTGATTATCAATCTGGAATTGAGCGGTCTTCCACTGGAAGAGTGGGATAATT
CCAGCTTGCGCTTCCACCTGACAGGAGACTCAGCTTCAGCCTCAATGCGCTATAAGTTTTTGTTCAATTA
TATCCGTGAGATTCAGATCAGCGGTGAAGACGGAAGCTTGTGCGTACTTGGGAAGAGCAATTTCAAGGCA
GTCGGCTTTGAGGATGACGAAGCACTGTTGCCTTATCCTTCGCAATCCTTTCCGGGTTACAGGATTTTAC
AGGAATATTTTATCCTGCCGGAAAAGTTTCTTTTTTTCGAGATTACAGGACTGGACAACTGGCGTAACCG
GGGCAGCAACGGAAAATTCAAGATAGTTCTGGAGCTGGAAAAGGTTCCGCAGACCTTTGACCGCTTCACT
AAAGACGATCTTTGCTTGTTTGCAACCCCGGCAATCAATTTGTTCAAGCGTGATGCCGAGCCGGTGATTC
TGGATCATAAGCGCCCGGAATATCAGGTTCGTCCTTCTGGAGATTCCGGTGGTGATTATCAGGTCTACTC
CGTGGATAACGTGGTCGGTTATGTTCAGGGTACTGTAGAGGAAAAGCCGTACAAACCATTTCATATGTTC
AATCCGCAGGCCGGGGAAATGCCTGTCTATACAGTGCACCACCGCCGTTCTCCGGTACGGGATAAAACGG
ATATTTTTGTTTCCGTGGCTTATCCGGCGCAGGGGGAGGAACCTGTTACCGAAACCCTGTCCATGGCCTT
GACCTGCACCAACGGAACCTTGCCGGAAAAGCTGCGTTACGGGGATATCAACAAACCAACCGGAACTTCA
CCGGAGCTGGCTTCATTTGAAAATATCCGCCAACCCACTTCCCCTGTACAGCCTCCGCTGGGACGGAACC
TGCTCTGGCGACTGCTTTCTCATCTTTACCTCAATTATCTTTCTGTTGCGGATATGGAAAGCCTGCGGGC
CATGGTCAAACTTTATATTTTTACTGATACCCGCGACCGCAGTTCGGTGGTCGCCAATACCAAACGAGTT
GAGGCCATTTCCGGCATGGAGGTCAGTGAGGGAGACCGTCTGGTACGCGGACTGGTCATGCGCGGCCGGG
AGATCAAGATGTCGCTCAGCTGTGACGGATTTGCCAACAGCGGCGATCTCTATCTGTTCAGTTCGGTGAT
GAACCGCTTTTTTTCCGGCTATGCCTCGGTCAATTGTTTCACCCGTCTGACTGTTGAGGACACCTTAAAC
AAGGAGATCTACAAGTGGACTGCGATGATCGGAAACCGTCCTCTTCTGTAA
 Primer design