SecReT6
Protein ID: 242277900
SecReT6 ID350
T6SS typei1
Gene symbol-
Locus tagDesal_0423
StrainDesulfovibrio salexigens DSM 2638
Repliconchromosome [GenBank: NC_012881] [Browse all T6SS(s) in this replicon]
Location [Strand]455888..456928 [+]
Producttype VI secretion protein
NoteTssG
UniProt IDC6BX10
KEGG IDdsa:Desal_0423
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 4.10E-74, Aligned region: 19..320
Protein Sequence: 346 a.a.     [Download]
>gi|242277900|ref|YP_002990029.1| type VI secretion protein [Desulfovibrio salexigens DSM 2638]
MDCDDRKPSSSVTGNLFNTPTGYSFFQAIRLLRLHSHHCTGKELEEFFRDHLRVRPQLSLGFPATDLTDI
EQEEGEDGDLYHLEATFLGLYGASSPLPVFYTEELLSEASEDKSVTRDFLNIVNNNAYIQFFRAWSRSRL
MIKAVDEQDHSWLERLDSLLGYGHYKAFSHVPPECRRYRHIGLLTQYPRSALGLETLLKDSLQHAKIHVE
QCVLRKVKIPEDQRFCLGESSNTLGERSWVGEELEDRNSKFAVHLQGLDSARYHRLLPGAEGGDKLDNLV
RGYLVEPFKYDLVLEMKPGEANTAVLGGDKWSGLGCDTWVFAGDHLEYAKASFPNKGGHIHERYEA
 
Nucleotide Sequence: 1041 bp     [Download]
>gi|242277482|ref|NC_012881.1|:455888-456928 Desulfovibrio salexigens DSM 2638 chromosome, complete genome
GTGGACTGCGATGATCGGAAACCGTCCTCTTCTGTAACCGGAAACCTGTTTAATACACCGACCGGGTATT
CCTTTTTTCAGGCCATCCGTCTGCTGCGGCTGCATTCGCATCATTGCACGGGTAAGGAGCTTGAAGAATT
TTTCCGTGATCACCTGCGGGTGCGTCCGCAGCTTTCACTCGGCTTTCCGGCAACCGATCTGACCGACATT
GAGCAGGAAGAAGGTGAAGATGGCGATCTTTACCATCTGGAAGCGACCTTTCTGGGGCTTTATGGAGCTT
CCTCGCCGCTGCCTGTTTTTTATACAGAGGAATTGCTGTCCGAGGCTTCGGAAGACAAGTCCGTTACCCG
CGATTTCCTGAATATTGTAAACAACAACGCGTATATACAGTTTTTCCGTGCTTGGAGCCGTTCAAGGCTG
ATGATTAAGGCTGTGGATGAGCAAGACCATTCATGGCTGGAGCGTTTGGACAGTCTGCTTGGTTACGGAC
ACTATAAGGCATTTTCCCATGTTCCGCCCGAGTGTCGCCGTTATCGCCACATCGGACTCTTAACCCAGTA
CCCGAGAAGTGCTCTGGGCCTTGAAACCCTGCTTAAGGATTCTTTGCAGCATGCAAAAATCCATGTGGAG
CAATGCGTGTTGCGTAAAGTTAAGATTCCAGAAGACCAGCGTTTTTGCCTTGGAGAAAGTTCCAACACGC
TTGGTGAACGATCTTGGGTCGGAGAGGAACTGGAAGACCGTAACAGCAAGTTCGCGGTACATTTGCAGGG
GCTTGATTCAGCCCGTTATCACAGGCTGCTGCCCGGTGCTGAGGGCGGGGATAAATTGGATAATCTGGTG
CGTGGCTATCTGGTGGAGCCGTTCAAGTATGATCTGGTTCTTGAAATGAAACCCGGCGAGGCAAACACGG
CTGTCCTAGGCGGAGATAAGTGGTCTGGTCTTGGCTGCGATACCTGGGTTTTTGCCGGGGATCATCTAGA
ATATGCAAAAGCGTCTTTTCCCAATAAAGGCGGACACATCCATGAGAGGTATGAAGCATGA
 Primer design