SecReT6
Protein ID: 242277901
SecReT6 ID350
T6SS typei1
Gene symbol-
Locus tagDesal_0424
StrainDesulfovibrio salexigens DSM 2638
Repliconchromosome [GenBank: NC_012881] [Browse all T6SS(s) in this replicon]
Location [Strand]456925..459570 [+]
ProductATPase AAA
NoteTssH
UniProt IDC6BX11
KEGG IDdsa:Desal_0424
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.20E-41, Aligned region: 222..241
AAA_2 [PF07724], Evalue: 1.20E-41, Aligned region: 609..777
AAA [PF00004], Evalue: 3.40E-20, Aligned region: 222..353
AAA [PF00004], Evalue: 3.40E-20, Aligned region: 614..738
ClpB_D2-small [PF10431], Evalue: 5.70E-15, Aligned region: 783..855
AAA_5 [PF07728], Evalue: 7.40E-14, Aligned region: 222..242
AAA_5 [PF07728], Evalue: 7.40E-14, Aligned region: 613..731
AAA_16 [PF13191], Evalue: 1.40E-12, Aligned region: 199..242
AAA_16 [PF13191], Evalue: 1.40E-12, Aligned region: 266..300
AAA_16 [PF13191], Evalue: 1.40E-12, Aligned region: 467..484
AAA_16 [PF13191], Evalue: 1.40E-12, Aligned region: 605..654
AAA_22 [PF13401], Evalue: 1.70E-08, Aligned region: 221..302
AAA_22 [PF13401], Evalue: 1.70E-08, Aligned region: 417..447
AAA_22 [PF13401], Evalue: 1.70E-08, Aligned region: 611..707
Zeta_toxin [PF06414], Evalue: 2.90E-06, Aligned region: 218..247
Zeta_toxin [PF06414], Evalue: 2.90E-06, Aligned region: 449..481
Zeta_toxin [PF06414], Evalue: 2.90E-06, Aligned region: 607..653
Sigma54_activat [PF00158], Evalue: 7.00E-05, Aligned region: 201..237
Sigma54_activat [PF00158], Evalue: 7.00E-05, Aligned region: 613..722
AAA_19 [PF13245], Evalue: 0.00011, Aligned region: 219..242
AAA_19 [PF13245], Evalue: 0.00011, Aligned region: 611..644
IstB_IS21 [PF01695], Evalue: 0.0005, Aligned region: 216..241
IstB_IS21 [PF01695], Evalue: 0.0005, Aligned region: 613..649
Arch_ATPase [PF01637], Evalue: 0.0012, Aligned region: 200..239
Arch_ATPase [PF01637], Evalue: 0.0012, Aligned region: 275..305
Arch_ATPase [PF01637], Evalue: 0.0012, Aligned region: 454..505
Arch_ATPase [PF01637], Evalue: 0.0012, Aligned region: 612..625
Arch_ATPase [PF01637], Evalue: 0.0012, Aligned region: 684..695
AAA_18 [PF13238], Evalue: 0.0021, Aligned region: 222..248
AAA_18 [PF13238], Evalue: 0.0021, Aligned region: 457..488
AAA_18 [PF13238], Evalue: 0.0021, Aligned region: 614..648
SRP54 [PF00448], Evalue: 0.0029, Aligned region: 222..243
SRP54 [PF00448], Evalue: 0.0029, Aligned region: 612..646
DUF258 [PF03193], Evalue: 0.0033, Aligned region: 207..239
DUF258 [PF03193], Evalue: 0.0033, Aligned region: 612..654
AAA_25 [PF13481], Evalue: 0.0037, Aligned region: 222..246
AAA_25 [PF13481], Evalue: 0.0037, Aligned region: 278..314
AAA_25 [PF13481], Evalue: 0.0037, Aligned region: 476..504
AAA_25 [PF13481], Evalue: 0.0037, Aligned region: 611..631
MobB [PF03205], Evalue: 0.0052, Aligned region: 223..244
MobB [PF03205], Evalue: 0.0052, Aligned region: 612..645
NACHT [PF05729], Evalue: 0.0056, Aligned region: 222..249
NACHT [PF05729], Evalue: 0.0056, Aligned region: 281..324
NACHT [PF05729], Evalue: 0.0056, Aligned region: 415..439
NACHT [PF05729], Evalue: 0.0056, Aligned region: 613..625
Protein Sequence: 881 a.a.     [Download]
>gi|242277901|ref|YP_002990030.1| ATPase AAA [Desulfovibrio salexigens DSM 2638]
MINVDIRNLLSKLDTFCTNALHNAAGLSVSLSNYEVSVEHFFIKCVEEVNSDLPLIFRQYGVETPRITAA
LTDVLQDFKTGNSGKPVFSPMLLELFEDAWLISSVELGETRIRSGAVLLAFLGKPNFYASGNYADLFSAI
NRETLLKEFWTVTKGSVEYKMPAAAPGEASAPAKGEGGFIERFCIDFTAKAREGGIDPVFGRDPEMRQMV
DILARRRKNNPILVGEPGVGKTAVIEGLALRITEGDVPEILSDVTLLGLDMGLLEAGAGMKGEFENRLKG
VIDEIKSSETPIILFIDEAHTLVGAGGSAGGADAANLLKPALARGELKTCAATTWTEYKKYFEKDPALAR
RFQLVKLDEPSVDTSTIILRGLRESYEKAHNVIIRDDANVAAAVYSDRYIAGRFLPDKAIDLLDTTCARV
KVNLSAKPGRLEDCQRVVQALEREKKAVDRDRSNAVEVDEDHYKDLLAQIEAKNAEAAEISEKWLKEKDA
AHAVLDVRAQIQEARNAEPIDEDGLSKLKDDLDKADAALTNLQSDDPMVQIEVTPDLVGRVVSDWTGIPV
GKMARDEAATVADLDDKLKVRIKGQDQGLASIAEVIRASKAGIKNPDQPIGVFLLVGPSGVGKTETGLSL
ADLLFGDERSVVTVNMSEFQEKHTVSRLIGSPPGYVGYGEGGMLTEAVRRQPYSVVLLDEVEKAHLDVMN
TFYQVFDKGVLTDGEGKDINFRNTILILTSNLGTDVIQEMTASLDPGDEMPMDAVLSAVRPILSQHFKPA
LLARMNVVPYFSLNPEAMKLITKLKLGKLEKMLLANNKMKLSYDDSVVDQIAARCTEVETGARNIEYILN
GNVLPKMSKEILIHMTEGGMPAAVHLGVDEDGSFNMEFSAE
 
Nucleotide Sequence: 2646 bp     [Download]
>gi|242277482|ref|NC_012881.1|:456925-459570 Desulfovibrio salexigens DSM 2638 chromosome, complete genome
ATGATCAATGTAGACATAAGAAATCTTCTTTCAAAGCTGGACACCTTCTGCACCAATGCATTGCATAACG
CAGCAGGCTTGAGTGTTTCGCTCAGCAATTACGAAGTTTCAGTGGAGCATTTTTTCATCAAATGTGTTGA
GGAAGTGAACAGCGATCTGCCGCTTATTTTCCGTCAATACGGAGTGGAAACCCCGCGTATTACTGCCGCC
CTTACGGATGTGTTGCAGGATTTCAAGACCGGAAATTCCGGCAAGCCCGTGTTTTCGCCCATGCTGCTGG
AGCTTTTTGAAGACGCATGGCTGATTTCTTCAGTGGAGCTTGGTGAAACCCGCATTCGTTCCGGTGCTGT
ACTCTTGGCCTTTCTGGGGAAACCTAATTTTTATGCTTCCGGCAATTACGCAGATTTGTTCTCAGCCATC
AATCGCGAGACTTTGCTCAAGGAATTCTGGACCGTAACCAAGGGATCAGTGGAATACAAAATGCCCGCTG
CCGCTCCCGGTGAAGCATCTGCTCCAGCCAAGGGTGAAGGCGGATTTATTGAGCGGTTCTGCATTGATTT
TACTGCCAAGGCCCGTGAAGGCGGTATTGATCCTGTTTTCGGACGTGATCCGGAAATGCGCCAGATGGTG
GATATTCTTGCCCGCCGCCGCAAGAATAATCCTATTCTTGTTGGTGAACCGGGGGTCGGTAAGACTGCGG
TCATCGAGGGGCTGGCCTTGCGCATCACTGAAGGCGATGTGCCGGAAATTTTAAGCGATGTGACCCTGCT
CGGTCTGGACATGGGACTGCTGGAAGCCGGAGCCGGAATGAAGGGCGAGTTTGAGAACCGTCTCAAGGGC
GTAATTGATGAAATCAAATCCAGCGAGACTCCGATCATCCTTTTTATTGATGAAGCGCATACTCTTGTTG
GTGCCGGAGGTTCCGCCGGGGGTGCGGACGCTGCTAACCTGCTTAAGCCTGCACTTGCCCGCGGGGAGCT
GAAAACCTGCGCTGCCACCACTTGGACCGAATACAAGAAATATTTTGAGAAAGACCCTGCTCTTGCCCGT
CGCTTTCAACTGGTCAAGCTGGATGAGCCGTCCGTTGATACTTCGACCATCATCCTGCGCGGTCTGCGTG
AAAGCTATGAAAAGGCTCACAACGTGATCATCCGTGATGATGCTAACGTTGCTGCCGCTGTTTACTCAGA
TCGCTATATCGCCGGACGTTTTCTGCCGGATAAAGCCATTGATCTGCTGGATACAACCTGTGCGCGGGTG
AAGGTTAATCTTTCGGCCAAACCCGGACGGCTGGAGGATTGCCAGCGCGTGGTGCAGGCTCTTGAACGCG
AAAAGAAGGCAGTTGATCGGGATCGCAGTAACGCGGTCGAAGTGGACGAGGATCATTACAAGGATTTGCT
GGCGCAGATTGAAGCGAAGAATGCTGAGGCCGCAGAAATCAGCGAAAAATGGCTTAAGGAAAAGGATGCC
GCCCATGCTGTTCTGGATGTGCGGGCGCAGATTCAGGAAGCTCGCAACGCTGAACCGATAGATGAAGACG
GTCTTAGCAAGCTCAAGGATGATTTGGACAAGGCTGACGCTGCGCTTACTAATCTTCAGTCTGATGATCC
TATGGTCCAGATTGAAGTCACTCCTGATTTAGTGGGCCGCGTTGTTTCCGACTGGACCGGAATTCCGGTG
GGCAAGATGGCCCGTGACGAGGCCGCAACAGTTGCGGATCTTGACGATAAACTCAAAGTCCGCATTAAGG
GACAGGATCAGGGGCTTGCCTCCATCGCCGAAGTCATCCGTGCTTCCAAGGCCGGAATCAAGAACCCGGA
TCAACCCATCGGGGTGTTTCTGCTGGTCGGTCCTTCCGGTGTGGGTAAGACCGAGACCGGACTTTCATTG
GCTGATTTACTTTTCGGCGATGAACGTTCCGTGGTCACCGTGAATATGAGTGAATTTCAGGAGAAGCATA
CCGTATCAAGGCTGATCGGTTCGCCTCCCGGTTATGTTGGTTACGGTGAAGGCGGCATGCTTACCGAGGC
CGTGCGCCGTCAGCCTTATTCCGTTGTTTTGCTGGATGAGGTGGAAAAGGCACATCTGGATGTGATGAAC
ACTTTTTATCAGGTCTTTGACAAGGGCGTGCTCACCGATGGCGAGGGCAAGGATATCAATTTCAGAAACA
CCATTCTTATTCTGACCTCCAACCTCGGCACGGATGTCATTCAGGAAATGACTGCCAGTCTTGATCCGGG
TGATGAAATGCCCATGGACGCTGTGCTTTCCGCTGTGCGGCCTATCCTTTCCCAGCACTTCAAGCCCGCA
TTGCTGGCTCGCATGAATGTGGTGCCTTACTTCAGCCTCAACCCTGAAGCCATGAAGCTGATCACTAAGC
TCAAGCTGGGCAAGCTGGAAAAGATGCTTCTCGCCAACAACAAAATGAAGCTGAGTTATGATGATTCCGT
GGTGGATCAAATCGCGGCCCGTTGTACCGAGGTGGAAACCGGAGCAAGAAATATTGAATATATCCTGAAC
GGCAATGTGCTGCCGAAGATGTCCAAGGAAATCCTGATACATATGACCGAGGGCGGTATGCCTGCGGCAG
TGCATCTGGGCGTGGATGAAGACGGTTCCTTTAATATGGAATTTTCCGCTGAATAA
 Primer design