SecReT6
Protein ID: 242277902
SecReT6 ID350
T6SS typei1
Gene symbol-
Locus tagDesal_0425
StrainDesulfovibrio salexigens DSM 2638
Repliconchromosome [GenBank: NC_012881] [Browse all T6SS(s) in this replicon]
Location [Strand]459592..461901 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDC6BX12
KEGG IDdsa:Desal_0425
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.80E-59, Aligned region: 29..330
Phage_base_V [PF04717], Evalue: 3.80E-16, Aligned region: 395..470
Reo_sigmaC [PF04582], Evalue: 0.0059, Aligned region: 655..767
Protein Sequence: 769 a.a.     [Download]
>gi|242277902|ref|YP_002990031.1| Rhs element Vgr protein [Desulfovibrio salexigens DSM 2638]
MADTSKPKFVFESKGADKNTFSVVRFKGTEGLSTIYRFSIMLISEKNDLDIGSILQNPAEFTIKRDDGDI
PFKGMLSSFEQLHQAGKICFYRAELVPKLWWATLTHCNQIFLNENAQGFLGDVLKKAGLKEGLNFDFKLQ
GSYPSWEYICQYDESHFNFVSRWMERDGMYYYFEQTDQGEKMVITDTHISHSPMKEGTSLTYSPPSNLDH
THREEIVKNFMLKQQPLPKKVLLKDYNYRKPSLEMKAEALVSQQGMGEIYIYGEHFKTPGEGNTLAQIRA
QEFLCREKVFHGVSTVPYIRTGYIFELKDHYRQDFNQRYLTTEVVHEGSQEAYLVSGLGLNLAEDADRLY
YRNSFTCIPANTQFRAERKAVKPKFAGTINAKVDASGSGQYAELDGEGRYKVIMPFDESGRSGGKATTWL
RMAQPYGGSNHGMHFPLHKGTEVLITCVEGDPDRPIIQSAAPNPENPSMVKDANQTKCIIVTGGQNLFHI
QDKQGSEGMHLKTPKDNTYVRLGSAAAEPAGSSSSMTEEKVKQIADEQIEAKKKEESLALSTEGNIKING
KNIASYILGNESKVVVGFSQLVNIGNDTKFFGALKEDIVVGMETGIKLALLNEITATKNGLVAGTALKAE
TEREELIADHHRMNIDMTKLNATCAEINGDLSTIREAHTNLAMDFDDLKGATAELAGESSKLAGEVENLG
GQLTEVAGDVSEVCGELTKIAGSKTKVSGEVIKACGDKTSAVAAFSQVSAESSQISGEMNNIAGLISNI
 
Nucleotide Sequence: 2310 bp     [Download]
>gi|242277482|ref|NC_012881.1|:459592-461901 Desulfovibrio salexigens DSM 2638 chromosome, complete genome
ATGGCAGATACTTCCAAACCCAAATTTGTGTTTGAGTCCAAGGGGGCGGATAAGAATACCTTCAGCGTGG
TCCGGTTCAAGGGCACCGAAGGCTTATCGACCATTTACCGTTTCAGTATCATGTTGATTTCGGAAAAGAA
TGACCTCGATATCGGTTCCATTCTTCAGAACCCTGCGGAATTCACCATCAAGCGTGATGACGGGGATATT
CCGTTTAAGGGTATGCTCAGTTCTTTTGAACAGCTTCATCAGGCCGGAAAGATTTGTTTCTACCGTGCAG
AACTTGTCCCGAAGCTCTGGTGGGCGACCCTGACTCATTGCAATCAGATATTCCTGAACGAAAATGCGCA
GGGATTCTTAGGTGATGTGCTCAAGAAGGCCGGACTTAAGGAAGGCCTGAATTTTGATTTCAAACTTCAA
GGATCGTATCCCTCATGGGAGTATATCTGCCAGTATGATGAATCCCATTTCAATTTTGTCTCCCGCTGGA
TGGAACGGGACGGCATGTATTATTATTTTGAGCAGACCGATCAGGGCGAGAAGATGGTTATCACCGATAC
CCATATTTCTCATTCACCCATGAAGGAAGGGACCAGCCTGACCTATTCCCCACCGAGCAATCTTGACCAC
ACCCACCGTGAGGAGATCGTCAAGAATTTCATGCTCAAGCAGCAGCCTCTGCCTAAAAAAGTGCTGCTCA
AGGATTACAACTACCGCAAGCCCAGTCTTGAAATGAAAGCCGAGGCCCTCGTTTCCCAACAGGGGATGGG
TGAAATCTACATTTACGGTGAACATTTCAAGACTCCGGGTGAAGGAAACACGCTGGCCCAGATCAGGGCG
CAGGAATTCCTTTGCCGTGAAAAGGTTTTTCACGGCGTTTCCACTGTTCCCTACATCCGCACCGGATATA
TTTTCGAATTGAAGGATCATTACCGTCAGGATTTCAACCAGCGCTACCTGACCACGGAAGTTGTGCACGA
GGGTAGTCAGGAAGCTTATCTTGTTTCCGGTCTGGGATTGAATCTCGCTGAAGACGCGGATCGTCTTTAC
TATCGCAATTCATTCACCTGCATACCTGCGAACACGCAGTTTCGTGCTGAGCGCAAGGCTGTGAAGCCTA
AGTTTGCAGGCACCATTAATGCCAAGGTCGATGCTTCGGGCAGCGGGCAATATGCCGAGCTGGATGGAGA
GGGCCGCTACAAGGTGATCATGCCTTTTGACGAATCCGGGCGCAGCGGCGGCAAGGCCACCACTTGGTTG
CGCATGGCTCAACCTTACGGTGGTTCCAACCACGGCATGCATTTCCCGCTGCATAAAGGCACAGAGGTAT
TGATCACATGTGTGGAGGGCGATCCGGACAGACCTATTATCCAGTCTGCGGCTCCCAACCCGGAAAACCC
CAGTATGGTCAAAGATGCCAACCAGACCAAGTGCATCATTGTTACCGGAGGCCAGAACCTTTTCCATATT
CAGGATAAGCAGGGCAGTGAGGGTATGCACCTCAAAACTCCCAAAGATAACACCTATGTGCGGCTTGGCT
CAGCAGCAGCGGAACCTGCAGGCAGCTCCAGTTCAATGACTGAGGAAAAAGTAAAGCAGATAGCTGACGA
GCAGATCGAAGCGAAAAAGAAAGAAGAAAGTCTAGCTCTCTCCACCGAGGGTAATATCAAAATTAACGGT
AAGAACATTGCCAGCTATATCCTCGGTAACGAGAGCAAGGTAGTTGTCGGATTTTCGCAGCTTGTGAACA
TCGGTAACGATACCAAGTTCTTCGGTGCGCTTAAGGAGGATATCGTTGTCGGCATGGAGACCGGAATAAA
ACTCGCCCTGCTCAATGAGATAACTGCCACAAAGAATGGTCTGGTGGCGGGTACGGCCCTTAAAGCCGAG
ACAGAGCGAGAGGAGTTGATAGCCGATCATCATCGTATGAACATAGATATGACTAAGCTTAATGCTACCT
GTGCTGAAATTAATGGCGATTTGAGCACTATCCGTGAAGCTCACACCAACTTAGCCATGGATTTTGATGA
TTTGAAAGGAGCTACCGCAGAGTTGGCAGGTGAGTCCAGCAAGCTTGCTGGAGAGGTGGAAAATCTTGGC
GGTCAGTTAACAGAAGTTGCCGGTGATGTCTCTGAAGTTTGTGGAGAATTGACTAAGATTGCCGGAAGTA
AAACTAAGGTGTCTGGAGAAGTTATTAAGGCATGTGGAGACAAGACTTCTGCAGTTGCGGCTTTCTCTCA
GGTTTCGGCTGAATCAAGCCAAATTTCAGGTGAAATGAATAATATCGCAGGTCTCATTAGCAATATTTAG
 Primer design