SecReT6
Protein ID: 242277908
SecReT6 ID350
T6SS typei1
Gene symbol-
Locus tagDesal_0431
StrainDesulfovibrio salexigens DSM 2638
Repliconchromosome [GenBank: NC_012881] [Browse all T6SS(s) in this replicon]
Location [Strand]469087..470541 [-]
Producthypothetical protein
NoteTssC
UniProt IDC6BX18
KEGG IDdsa:Desal_0431
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.90E-23, Aligned region: 135..347
DUF770 [PF05591], Evalue: 0.0014, Aligned region: 3..77
Protein Sequence: 484 a.a.     [Download]
>gi|242277908|ref|YP_002990037.1| hypothetical protein Desal_0431 [Desulfovibrio salexigens DSM 2638]
MHIELPSFKLLMLAPFSPTLATDNPPRIKADPSSIDQALAEINPSLDISLDRNHFPAASINISISRMADF
RPKNISRTPEFKNITSQMAEDSPPSKQTTPTPRSSAVLDDILSMVNSGQNDHPTATSSRHERPKSELLQA
VFADSVFRKMESPWRGLELLSRQVPSGSKVSVEFMLVPISENNLIPVLDKLEQELADSPPELILVDHSLN
NSPRSMEILERIMDFAESMIAPAMVAFGPKFLELENWAEADKLPFIPTLLEGAEYGRWKTLRPQPSAGWI
IGCAGTIMGRTMHSPEAGFEQTSLSERGPLWTNSVWGAAALCTRSLSEHGRSTLFADHSSTRLDGLPLAE
GPRPAPINPPLGTERIKDFRQAGINVLAFNGDQAFLIGATTIDGGPANLRFYLSGLIHFLILLSTAKRKE
FSDIESQLTEAIALFLQQQGYPQPQDLSIKKGEPSGETIPLEISITPGAEILPGNAPISFGFNW
 
Nucleotide Sequence: 1455 bp     [Download]
>gi|242277482|ref|NC_012881.1|:c470541-469087 Desulfovibrio salexigens DSM 2638 chromosome, complete genome
ATGCATATCGAGCTTCCGTCTTTCAAATTATTAATGCTGGCCCCCTTTTCCCCGACTCTGGCAACAGACA
ATCCCCCGCGCATAAAGGCCGATCCATCTTCCATAGACCAAGCTCTGGCTGAGATTAACCCCAGTCTTGA
TATCTCTCTGGACCGCAACCATTTCCCCGCTGCATCCATCAATATTTCCATCAGCAGAATGGCGGATTTC
AGGCCCAAGAATATCAGCCGAACCCCGGAATTTAAAAATATCACCAGCCAGATGGCAGAAGACTCACCCC
CTTCAAAACAAACAACGCCCACTCCCAGAAGTTCCGCCGTTCTTGATGACATCCTTTCCATGGTCAACAG
CGGACAGAACGATCACCCCACAGCCACGTCCAGTCGACACGAACGCCCCAAAAGCGAACTGTTGCAAGCA
GTTTTCGCTGATTCAGTTTTCAGAAAAATGGAGTCCCCATGGCGCGGTCTGGAATTGCTGTCCCGGCAGG
TTCCTTCCGGCAGCAAGGTCAGTGTTGAATTCATGCTCGTCCCCATTTCCGAGAACAACCTGATTCCAGT
TCTGGATAAACTGGAGCAGGAGCTTGCTGATTCCCCACCGGAGTTAATTCTGGTCGATCACAGCCTGAAC
AATTCGCCACGGTCAATGGAAATTCTGGAACGGATCATGGATTTTGCGGAATCCATGATCGCCCCGGCAA
TGGTGGCTTTCGGGCCGAAATTCCTTGAGCTGGAAAACTGGGCCGAAGCAGACAAACTGCCCTTCATCCC
AACCCTGCTGGAAGGCGCGGAATACGGACGCTGGAAAACTCTGCGCCCGCAGCCTTCCGCCGGATGGATA
ATCGGTTGTGCCGGAACCATCATGGGCAGGACCATGCACTCACCTGAAGCCGGATTTGAACAAACGTCCC
TTTCCGAACGGGGGCCACTCTGGACTAACTCCGTATGGGGCGCAGCAGCCCTCTGCACCCGCAGCCTTTC
CGAACACGGCAGGTCCACCCTTTTTGCAGACCATTCCAGCACTCGGCTGGACGGATTACCCCTTGCCGAA
GGCCCAAGACCTGCACCGATCAATCCGCCCCTAGGAACAGAACGAATCAAGGATTTCCGACAGGCTGGCA
TAAACGTCCTCGCCTTTAACGGCGATCAGGCTTTTCTAATCGGCGCAACAACCATAGACGGTGGTCCGGC
AAATCTGCGGTTCTATCTTTCAGGATTGATTCATTTTCTGATTCTATTATCAACGGCAAAGCGCAAAGAA
TTCAGCGACATTGAATCGCAATTAACCGAAGCAATTGCACTGTTCCTCCAGCAGCAGGGATATCCGCAAC
CGCAGGATTTGAGCATCAAAAAAGGAGAACCGTCCGGCGAGACGATTCCCCTTGAGATTTCCATTACTCC
GGGCGCGGAAATCCTGCCCGGGAATGCACCCATTAGCTTTGGATTTAATTGGTGA
 Primer design