SecReT6
Protein ID: 242277909
SecReT6 ID350
T6SS typei1
Gene symbol-
Locus tagDesal_0432
StrainDesulfovibrio salexigens DSM 2638
Repliconchromosome [GenBank: NC_012881] [Browse all T6SS(s) in this replicon]
Location [Strand]470739..471311 [+]
Producttype VI secretion lipoprotein
NoteTssJ
UniProt IDC6BX19
KEGG IDdsa:Desal_0432
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 4.30E-25, Aligned region: 14..184
Protein Sequence: 190 a.a.     [Download]
>gi|242277909|ref|YP_002990038.1| type VI secretion lipoprotein [Desulfovibrio salexigens DSM 2638]
MRGRLLILLLLLLVAVCSCGGKQKPVNPTTVTTPASSPDQMKWTYQINAISFKLGVDKNLNEYDDAPHTL
LLCFYQLSNLSKFNELAGTSTGVEKMLNCTSFDQSVTQVKREFVQPGRNSTITMDRAEGTKFVGVVAGYY
DLQGKASRTWQIPMDVSETGMLWWGDTWYAPAKLDAMIILGPHEIQKVGE
 
Nucleotide Sequence: 573 bp     [Download]
>gi|242277482|ref|NC_012881.1|:470739-471311 Desulfovibrio salexigens DSM 2638 chromosome, complete genome
GTGCGCGGCAGATTATTGATACTCCTGTTACTCCTGCTAGTGGCTGTTTGCAGTTGCGGTGGCAAACAAA
AGCCGGTTAACCCGACAACTGTGACCACTCCGGCTTCAAGTCCGGATCAGATGAAGTGGACTTACCAGAT
CAATGCCATTTCCTTTAAGCTGGGTGTGGATAAGAATCTCAATGAATATGATGATGCTCCACATACCTTG
CTGCTCTGTTTTTATCAGCTTTCAAATCTAAGTAAATTCAATGAATTGGCAGGCACTTCCACCGGTGTGG
AAAAGATGCTCAATTGCACCAGCTTTGACCAGAGTGTTACGCAGGTCAAACGTGAGTTTGTACAGCCGGG
ACGCAATTCGACCATCACCATGGACCGTGCCGAGGGTACCAAGTTCGTGGGTGTGGTTGCCGGATATTAT
GATTTACAGGGCAAGGCTTCACGCACTTGGCAGATTCCCATGGATGTGAGTGAGACGGGCATGCTTTGGT
GGGGAGATACCTGGTACGCCCCTGCCAAGCTGGATGCAATGATCATTCTCGGACCCCATGAAATTCAAAA
GGTGGGGGAGTAG
 Primer design