SecReT6
Protein ID: 242277910
SecReT6 ID350
T6SS typei1
Gene symbol-
Locus tagDesal_0433
StrainDesulfovibrio salexigens DSM 2638
Repliconchromosome [GenBank: NC_012881] [Browse all T6SS(s) in this replicon]
Location [Strand]471315..472694 [+]
Producttype VI secretion protein
NoteTssK
UniProt IDC6BX20
KEGG IDdsa:Desal_0433
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 5.30E-88, Aligned region: 19..456
Protein Sequence: 459 a.a.     [Download]
>gi|242277910|ref|YP_002990039.1| type VI secretion protein [Desulfovibrio salexigens DSM 2638]
MHADKPLFWHQGLFLQPQHFQLSDLHQLHRFRAMRQYGLPYFWGVSGLKVREGALERKKFEVTEIEVFFD
DGNLVTFPGNAHIEPRSFEDAWEEGGKPFTVYLGLRKWNPEGGNVAQVEDTAASVNTMYAVSPDPVEQPD
LLGSGPAAQIKPMRYVLRLFWENELDDLGAYNIIPLARLERDVQEVCLDESFVPPCITLSASRWLRHVFS
DISDQVASRCRRLEQYKNPAGLGSGDLDFTSTVFLLVLRTLNRYAPQLDHFAAAPHIHPWHAYGLLRQII
GELSSFSREMSALGEGPDGKKVLPDYDHENIGPCFEKAREIITNILDSLTAGPEFMSQFVFSDPYFTVEL
PERAFVAGNSFWLLIKTENPEQALPELMNIAKLSATHGMSNLLARAVQGIGMVHMENLPPGLPRSKDALC
FRIDTESPHWEDVVRSGSLSLYWDSAPSDLAVYIAAMRG
 
Nucleotide Sequence: 1380 bp     [Download]
>gi|242277482|ref|NC_012881.1|:471315-472694 Desulfovibrio salexigens DSM 2638 chromosome, complete genome
ATGCATGCAGATAAGCCATTGTTCTGGCATCAGGGACTGTTCCTGCAACCCCAGCATTTCCAGCTTTCGG
ACCTGCATCAGCTGCATCGTTTCCGGGCTATGCGCCAGTACGGATTGCCGTATTTCTGGGGGGTCTCCGG
GTTAAAAGTCCGTGAGGGTGCCCTTGAACGCAAAAAATTTGAAGTTACTGAAATTGAAGTCTTCTTTGAT
GATGGTAATCTTGTGACCTTTCCGGGCAATGCCCATATTGAACCCCGTTCCTTTGAGGACGCATGGGAAG
AGGGCGGAAAGCCTTTCACTGTCTATCTGGGGCTGCGCAAGTGGAATCCGGAAGGCGGCAATGTTGCGCA
GGTTGAAGATACCGCCGCTTCGGTGAATACTATGTACGCAGTTTCCCCGGATCCGGTTGAACAACCGGAC
CTGCTGGGCAGCGGGCCTGCGGCCCAGATCAAGCCCATGCGCTATGTTTTGCGTTTATTCTGGGAAAATG
AACTGGATGATCTGGGGGCCTACAACATTATTCCCTTGGCCCGTTTGGAGCGTGATGTTCAGGAAGTGTG
CCTTGATGAAAGCTTTGTTCCTCCTTGCATCACCCTGAGTGCTTCAAGATGGCTGCGCCATGTTTTCAGT
GACATCAGTGATCAGGTTGCTTCGCGTTGCCGCAGGCTGGAACAGTATAAGAATCCTGCCGGACTCGGGT
CCGGTGATCTTGATTTTACTTCCACCGTTTTCCTGCTGGTTTTGCGTACCTTGAACCGTTACGCCCCGCA
GCTGGATCATTTTGCTGCGGCTCCGCATATCCATCCGTGGCACGCTTATGGGCTGCTGCGGCAGATTATC
GGGGAGCTGTCATCATTCTCACGGGAAATGTCCGCTCTTGGGGAAGGCCCTGACGGAAAGAAGGTCCTGC
CCGATTACGACCATGAAAATATTGGGCCCTGTTTTGAAAAGGCTCGCGAGATTATCACAAATATTTTGGA
CAGCCTGACTGCCGGACCGGAATTCATGAGCCAGTTCGTGTTCAGTGATCCTTACTTCACCGTGGAATTG
CCGGAACGTGCCTTTGTTGCCGGGAACAGCTTCTGGCTGCTGATAAAGACCGAGAATCCGGAACAGGCTT
TGCCGGAACTCATGAATATCGCCAAGCTTTCCGCAACCCACGGCATGAGTAATCTGCTGGCCCGAGCGGT
ACAGGGTATAGGCATGGTTCATATGGAAAATCTGCCTCCCGGATTGCCTAGGTCCAAGGATGCCCTGTGC
TTCCGCATTGATACCGAATCCCCGCATTGGGAGGACGTGGTCCGTTCAGGAAGTCTTTCTCTTTATTGGG
ATAGCGCGCCCAGTGACCTTGCGGTCTATATAGCCGCCATGAGGGGATAG
 Primer design