SecReT6
Protein ID: 242277911
SecReT6 ID350
T6SS typei1
Gene symbol-
Locus tagDesal_0434
StrainDesulfovibrio salexigens DSM 2638
Repliconchromosome [GenBank: NC_012881] [Browse all T6SS(s) in this replicon]
Location [Strand]472763..473488 [+]
ProductDotU family type IV / VI secretion system protein
NoteTssL
UniProt IDC6BX21
KEGG IDdsa:Desal_0434
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.50E-37, Aligned region: 2..111
DUF2077 [PF09850], Evalue: 1.50E-37, Aligned region: 137..232
Protein Sequence: 241 a.a.     [Download]
>gi|242277911|ref|YP_002990040.1| DotU family type IV / VI secretion system protein [Desulfovibrio salexigens DSM 2638]
MHLSDCFLELFTYIRLLTESAEMAGAEYEQVRDDVRTLITRMDDRSDLVGVPEDLYNDARFAVFAWADEA
VLISKWAGVRDWLKHPLQREFYGTANAGEEFFERLDKLFNRNNGPVDQSLFADMEKEGQPVNDNGLSEVL
EVYALCLSLGFTGKYFSESGEERLEELHRECVARIPGSEKGSGPFFPQSYGTGEAAPRKCCYGRIFDPVS
LIFFILPVLVVGGMYFAYKVLLEQSLKLWFG
 
Nucleotide Sequence: 726 bp     [Download]
>gi|242277482|ref|NC_012881.1|:472763-473488 Desulfovibrio salexigens DSM 2638 chromosome, complete genome
ATGCATCTCTCTGATTGCTTCCTCGAACTCTTCACCTACATAAGGCTATTGACCGAATCTGCGGAAATGG
CTGGCGCTGAGTATGAGCAGGTGCGTGATGATGTGAGGACGCTGATCACCCGCATGGATGACCGTAGCGA
TCTAGTGGGGGTACCGGAAGATCTTTACAACGATGCACGTTTTGCGGTTTTTGCCTGGGCCGATGAAGCT
GTGCTGATTTCGAAATGGGCCGGGGTGCGTGATTGGCTTAAACATCCTTTGCAGCGCGAGTTTTACGGAA
CAGCCAATGCGGGCGAGGAATTCTTTGAGCGACTGGATAAGCTTTTCAACCGCAACAACGGTCCGGTGGA
TCAAAGCCTTTTTGCTGATATGGAAAAGGAAGGTCAACCGGTCAATGACAATGGATTGTCCGAAGTTCTG
GAAGTTTACGCCCTCTGCCTCTCCTTAGGTTTTACCGGGAAGTATTTCAGTGAATCCGGGGAAGAGCGTT
TGGAAGAGCTGCACCGGGAGTGCGTGGCCCGCATACCCGGAAGTGAAAAGGGGAGCGGTCCGTTTTTTCC
ACAATCTTACGGGACAGGTGAGGCTGCGCCGCGAAAATGCTGTTACGGGCGCATTTTTGATCCTGTTTCC
CTGATCTTTTTTATCCTGCCTGTGCTTGTAGTTGGCGGGATGTACTTTGCTTACAAGGTTCTGCTTGAGC
AGAGCTTAAAGCTCTGGTTCGGTTAG
 Primer design