SecReT6
Protein ID: 242277912
SecReT6 ID350
T6SS typei1
Gene symbol-
Locus tagDesal_0435
StrainDesulfovibrio salexigens DSM 2638
Repliconchromosome [GenBank: NC_012881] [Browse all T6SS(s) in this replicon]
Location [Strand]473582..477085 [+]
Producthypothetical protein
NoteTssM
UniProt IDC6BX22
KEGG IDdsa:Desal_0435
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 2.60E-56, Aligned region: 183..436
DUF1215 [PF06744], Evalue: 0.0023, Aligned region: 962..1011
Protein Sequence: 1167 a.a.     [Download]
>gi|242277912|ref|YP_002990041.1| hypothetical protein Desal_0435 [Desulfovibrio salexigens DSM 2638]
MKKFLLNLLKIIFIVLLFVLAAVASYALVTYMGWPWWAGACLFGGVIGLVAAFFFIRKWMLRRREKKFVK
RIVDQDDSAIAAAPLHERSRLQELQTRWTEAVQLLQNSELRRHGNPLYALPWFMVFGESDSGKSTAVASS
RLTSILSDVGPTPGVSATRNCDWWFFEEAVILDTAGRYAIPIDESRDKEEWEKFLTLLVKYRKREPLNGL
IITLPADRLQSGDEDSLNEYGRSLRRRVNELMRVLGVRFPVYVLLTKMDLVFGLKGLTEVLPDEARSQAM
GMVNESMTSDPEEFVDTAVSGVIERLRALRMTLLDRENSFDPAFLLFAEELDRLRPRIRAFADGVFEENP
YQEQPLFRGIYFSSGEQSGEQSSAFLDSLPSLQNVETKLPGTRQGLFLHDFFSKVLTRDRNLFTPIIEFL
KWKLLTRNMGMLVWLLLLFFVCGLFSMSFLGNRRALDDLFTAFPKPPEFSEKIDECVVEMEGFRQKIVHL
HDLNSNWWVPRMGLDVSLEAEQKVRKLYVEKFESALLKPVDTQLSRTIESLHAGSSEQEVSDFVKLLGWR
IDLLDNRIEGGKVKPLAPYELPSGQAMSMAVPGFESDLMKYYGQTYSSYLDWIENDEGLKEQRLLLQARL
GKVFSLKGSDFKWLVDWVDSNPEVQPVTLRDFWGGPRLHFENEVHVPPAYTTTGHKMLTDFLGELRRAMP
DNTDFAQREKDFWNWYAEQFYRSWYSFSEHFTEGERQLLTKDDYSSMAHTMANADNPYFKLLGRMKEEFS
VIKGLGTAPDWIADLFDFNIVLTQYKAMKAKGVEESSQKAEESLRKIMADLGGKMAENIEARIEGAKQLD
EYMQVLHDLAGFTTSQETAFKSAAALYPATGQSSEGSGAESKSAGAVKKNPVDGATRAMAALRTRMRSGG
QGTHMFWNLVAGPLEFMVYVITMEASCELQQLWEGKVLAETAHVPSDKLRTTLFGKSGIVNKFTSSSASP
FLSKGVKGWQSRQWLGIPFPFREEFFVFLNDGEQGAQEIQPEYKVGLSTIPTSVNSNATQEPYATTLSLE
CGSGRQELVNYNYSEKTTFTWKPDQCGTTTLTIRFPGIDLVKTYEGKLGFAKFLSEFRNGEVNFSPKDFP
DQAKGLQGLGVSSVKVGYNFSGAVPVIEVLQIKPLNLPNFITDCWEN
 
Nucleotide Sequence: 3504 bp     [Download]
>gi|242277482|ref|NC_012881.1|:473582-477085 Desulfovibrio salexigens DSM 2638 chromosome, complete genome
ATGAAGAAATTTCTACTCAATCTGCTCAAGATCATCTTTATTGTGCTGCTTTTTGTGCTGGCGGCAGTAG
CCTCCTATGCCCTTGTTACTTATATGGGCTGGCCGTGGTGGGCCGGAGCTTGTCTTTTCGGCGGGGTGAT
CGGGCTGGTTGCAGCTTTCTTTTTCATCCGCAAATGGATGTTGCGCAGGCGGGAGAAGAAGTTTGTAAAA
CGCATTGTGGATCAGGATGATTCGGCCATTGCCGCCGCCCCGCTGCATGAGCGTTCCCGCTTGCAGGAAC
TTCAGACCCGCTGGACTGAGGCTGTGCAACTGCTCCAGAATTCGGAACTGCGCAGGCATGGCAACCCCTT
GTACGCTCTGCCGTGGTTTATGGTTTTCGGTGAATCTGATTCCGGTAAGAGCACTGCGGTCGCCAGCAGC
AGGCTGACCTCTATTCTTTCAGATGTAGGGCCTACTCCCGGAGTTTCCGCTACACGCAATTGTGACTGGT
GGTTTTTTGAAGAGGCGGTCATCCTTGATACTGCCGGACGTTACGCCATTCCCATTGATGAATCACGGGA
TAAGGAAGAGTGGGAGAAATTCCTGACACTGCTGGTCAAATACCGCAAACGTGAGCCTCTCAACGGGTTG
ATCATCACTCTGCCTGCCGACCGTCTGCAATCCGGAGATGAAGACAGTCTGAACGAATACGGGCGCAGTC
TGCGGCGGCGGGTCAATGAACTTATGCGCGTGCTGGGTGTGCGTTTTCCTGTCTACGTATTGCTGACCAA
GATGGATCTTGTTTTCGGGCTCAAAGGGCTGACTGAGGTTCTTCCTGATGAGGCCCGTTCGCAAGCAATG
GGCATGGTAAATGAGTCCATGACTTCCGACCCCGAAGAATTTGTGGATACTGCTGTTTCCGGTGTTATCG
AACGTCTGCGTGCTCTGCGTATGACCCTGTTGGATCGGGAGAACAGCTTTGATCCCGCTTTCCTGCTCTT
TGCCGAGGAACTGGACCGTTTACGCCCGCGCATCCGGGCTTTTGCGGACGGTGTGTTCGAGGAGAATCCC
TATCAGGAGCAACCGCTGTTCCGGGGAATTTATTTTTCCAGCGGCGAACAGAGCGGTGAGCAGAGTTCCG
CTTTTCTGGACAGTCTTCCTTCTTTGCAGAACGTTGAAACAAAGCTTCCGGGCACTCGTCAGGGTTTGTT
CCTGCACGACTTCTTTTCCAAGGTCCTGACCCGTGACCGCAATTTGTTTACCCCCATAATTGAATTCCTC
AAATGGAAGCTGCTCACCCGCAATATGGGAATGCTGGTCTGGTTGTTGTTGCTGTTTTTCGTTTGCGGCC
TGTTCAGCATGTCCTTTTTGGGCAACCGTCGTGCTCTGGATGATCTTTTTACCGCCTTCCCGAAACCACC
AGAGTTCTCTGAAAAGATTGATGAATGTGTTGTAGAGATGGAAGGTTTCCGTCAGAAAATAGTGCATTTG
CACGATTTGAATTCAAACTGGTGGGTTCCGCGTATGGGGCTTGATGTCAGCCTTGAAGCGGAGCAGAAGG
TCCGCAAACTTTATGTTGAAAAGTTTGAATCTGCATTGCTGAAACCTGTGGATACTCAGTTGTCACGAAC
AATTGAAAGCTTGCATGCCGGTTCTTCGGAGCAGGAAGTCAGTGATTTCGTCAAGTTGCTCGGCTGGCGC
ATTGATCTGCTCGATAATCGGATTGAAGGCGGAAAAGTAAAGCCCTTGGCTCCGTACGAACTACCTTCCG
GTCAGGCCATGTCTATGGCTGTTCCGGGGTTCGAGTCGGACCTGATGAAGTATTATGGGCAAACTTATAG
TTCATATCTTGATTGGATTGAAAATGATGAAGGGTTAAAAGAGCAAAGGCTGCTCTTGCAGGCACGTCTG
GGTAAAGTCTTCAGTCTTAAGGGATCGGATTTTAAGTGGCTGGTGGATTGGGTTGATTCCAATCCTGAAG
TGCAGCCGGTGACCCTGCGCGATTTTTGGGGCGGGCCGCGACTGCATTTTGAAAACGAGGTCCATGTTCC
CCCTGCTTACACGACCACCGGACACAAGATGCTTACTGATTTCCTTGGGGAATTACGCAGGGCAATGCCG
GATAATACGGATTTCGCACAACGAGAAAAGGATTTCTGGAATTGGTATGCAGAGCAATTCTACCGCTCAT
GGTATTCTTTTTCCGAGCATTTTACCGAAGGTGAGCGTCAGTTGCTGACTAAAGATGATTACAGCAGCAT
GGCTCATACTATGGCTAATGCCGACAACCCTTACTTCAAGCTGCTAGGCAGGATGAAAGAGGAATTTTCG
GTAATAAAGGGATTGGGAACTGCCCCGGATTGGATTGCTGATCTTTTTGATTTCAACATTGTGCTGACCC
AGTACAAGGCCATGAAAGCCAAGGGTGTAGAAGAATCTTCCCAGAAGGCAGAGGAGTCCCTGCGTAAAAT
CATGGCGGATCTGGGCGGCAAGATGGCTGAAAATATTGAGGCCCGTATTGAGGGAGCCAAACAGCTCGAT
GAGTACATGCAGGTGTTGCATGATCTGGCCGGGTTTACCACCAGTCAGGAAACAGCCTTTAAGAGTGCGG
CTGCTCTTTATCCTGCTACCGGACAGAGTTCTGAAGGCAGCGGGGCGGAGAGCAAGTCTGCCGGAGCAGT
GAAGAAGAATCCTGTGGACGGAGCTACCAGAGCTATGGCCGCTTTGCGCACCCGCATGCGTAGTGGAGGG
CAGGGCACCCATATGTTTTGGAATCTTGTGGCCGGACCGCTGGAGTTCATGGTCTACGTGATCACCATGG
AAGCTTCCTGCGAATTGCAGCAGCTTTGGGAAGGCAAAGTGCTGGCTGAAACGGCCCACGTACCTTCGGA
CAAGCTGCGGACCACTTTGTTCGGCAAAAGCGGAATTGTTAATAAGTTTACTTCAAGCAGTGCTTCTCCT
TTCCTGAGCAAAGGAGTTAAGGGCTGGCAAAGCCGTCAATGGCTGGGAATTCCTTTTCCGTTCCGTGAAG
AATTCTTTGTTTTTCTCAATGACGGAGAGCAGGGAGCACAGGAAATTCAGCCTGAATACAAGGTCGGATT
GTCTACCATTCCTACTTCCGTGAATTCCAATGCCACGCAGGAGCCGTACGCCACAACCCTATCCCTTGAA
TGCGGCAGTGGCAGACAGGAGTTGGTAAACTATAACTATTCCGAAAAGACGACTTTCACATGGAAGCCTG
ATCAGTGCGGTACAACCACCCTGACCATCCGTTTTCCGGGTATTGATCTGGTCAAGACCTATGAGGGCAA
GCTTGGTTTTGCCAAGTTCTTGTCCGAGTTCCGTAATGGCGAGGTCAATTTCAGTCCCAAGGATTTTCCG
GATCAGGCCAAGGGCTTGCAAGGTCTGGGCGTAAGCAGTGTAAAGGTCGGCTACAATTTCAGCGGTGCTG
TTCCGGTTATCGAGGTCTTACAGATCAAGCCCTTGAACCTGCCCAATTTTATAACCGATTGCTGGGAAAA
TTAA
 Primer design