SecReT6
Protein ID: 251790376
SecReT6 ID351
T6SS typei1
Gene symbol-
Locus tagDd1591_2794
StrainDickeya zeae Ech1591
Repliconchromosome [GenBank: NC_012912] [Browse all T6SS(s) in this replicon]
Location [Strand]3172120..3175617 [-]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDC6CNU2
KEGG IDdze:Dd1591_2794
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 4.30E-91, Aligned region: 505..819
ImcF-related_N [PF14331], Evalue: 4.70E-70, Aligned region: 201..458
DUF1215 [PF06744], Evalue: 2.00E-31, Aligned region: 905..1023
Protein Sequence: 1165 a.a.     [Download]
>gi|251790376|ref|YP_003005097.1| type VI secretion protein IcmF [Dickeya zeae Ech1591]
MLKIIITFLRQQLPKLKPSWLLLGVVVWVVALVLAWWLGPRLTLGEMRPLQSVWGRVVFTLVWLWLGFAY
SAWRVWRRVQQLRAERREQQTIEQDPLQVYVDSQQTFLDRWLQAFQTQLGKKALYAMPWYLAIGLSGSGK
SSLIHRANPANKLNPKLDAELREVAGGQQVNSWVGESAVIWDPSGQLLAQPEVGAEPSAGRHARLWQHLL
QWLSLNRRRQPLNGLVLTIDLSWLSQASVSERKAYAQVMRARLQEIAVNINTRLPLYVALTRLDMLRGFD
VVYRSLNREARQAVLGVTFTPQASHGKGWLEELERFWDDWIANLNNNLPEMLLTQSDSGVRNTLFAFVRQ
LAGLKDYVTEVLSETLATGDDRAFLVRGVYVSSVYQQGVPFDAFAQSASRRYQLPEPINAAMRGESNTFF
VQKLFPEVIFPEASLAGENRLHSLYRRRRMSIGITCMVLFGLAMIGSWHHFYRVNEEAGRNVLTKAQAFI
GTNELEGQAGYGYQQLPRLNLIRDATLSFGNYHERTPMMADLGLYQGDKIGPYVEGSYLQMLNQRFLPAV
MQGLLEDLNQAPAGSEQKLTILRVMRMLDDASGRNKTLVEQFMALRWQKAFPGQGKVQEQLMQHLDYALE
RTDWHQSREQKDAVAMSTFAPFVDPIAAAQRELSKLPMYQRVYQSLVMKATQVLPPDLALRDEVGPTFDS
VFSLRNDKAGMVPRLLTYPGFSDFYLKQDKTLLDLTALDAWVLGQRERAHLSEADRKEILRQVNDRYITD
YINQWQKVLANIDVQPLESPEQALNILTDITGNDQPFQRVLTTVSDNTRIRKLADDENDTAQGINTRIGR
PFMTINAALSGRGEQGPLVQEVNQKLTDLYHYLDQIVNATDPGQAALKAVQARQGNKFADPVFALQQYAR
SLPAPLDRWVGQLAGESASLVTGLAMSSLNQEWMDKVVTPFNDKLADRYPFNPSSDKDVPLSEMERFFAV
GGTLDSFYQTNLKSIMDGGMLEGEGASPLQTELVKQLDRATRIRQTLFNAQGSLEIHFVVEPVELTANKR
RSVLNLDGQLLEYSHGRRTKTPLVWPNSMRDGAESKLTLVPDDRERSPRSLSFTGPWAMFRLLTNGQLTQ
VNDNTFDVRFSLEQGGMTYRVYTDASHNPFAGGLFSQFKLPDSLY
 
Nucleotide Sequence: 3498 bp     [Download]
>gi|251787652|ref|NC_012912.1|:c3175617-3172120 Dickeya zeae Ech1591 chromosome, complete genome
ATGTTGAAAATAATCATTACCTTTCTGCGGCAACAGCTGCCGAAACTGAAACCATCCTGGCTGCTGTTGG
GGGTGGTGGTATGGGTGGTGGCGTTGGTACTGGCCTGGTGGCTGGGGCCGCGTCTGACCCTCGGCGAGAT
GCGCCCGCTGCAAAGCGTGTGGGGCCGCGTGGTGTTCACGCTGGTCTGGCTGTGGCTGGGCTTTGCCTAC
AGCGCCTGGCGCGTCTGGCGGCGGGTACAGCAACTGCGCGCGGAGCGCCGTGAACAGCAGACTATCGAGC
AGGACCCCTTGCAGGTATACGTTGATAGCCAGCAAACCTTTCTGGACCGTTGGCTACAGGCGTTTCAGAC
CCAACTGGGCAAAAAAGCGTTGTACGCCATGCCCTGGTATCTGGCCATTGGCCTGTCCGGCAGCGGTAAA
AGCAGCCTGATTCATCGTGCCAACCCGGCCAATAAGCTCAACCCGAAACTGGATGCGGAGTTGCGTGAAG
TGGCCGGCGGCCAGCAGGTGAACAGTTGGGTCGGCGAGTCGGCGGTGATTTGGGACCCCAGCGGCCAATT
GCTGGCCCAGCCGGAAGTCGGCGCGGAGCCGTCGGCCGGACGTCACGCCCGCCTGTGGCAGCATCTGTTG
CAGTGGCTGAGCCTCAACCGTCGTCGCCAGCCGCTGAACGGGCTGGTGCTGACTATCGACCTGTCCTGGC
TGTCGCAGGCCAGCGTGTCGGAGCGTAAGGCGTATGCACAGGTGATGCGCGCGCGGTTGCAGGAGATTGC
GGTCAATATCAATACCCGCCTGCCGCTGTACGTGGCGCTGACCCGTCTGGATATGCTGCGCGGTTTTGAC
GTGGTGTACCGCTCGTTGAACCGGGAAGCGCGTCAGGCGGTGCTCGGGGTGACGTTTACCCCGCAGGCCA
GCCACGGCAAAGGCTGGCTGGAAGAGCTGGAGCGCTTTTGGGACGACTGGATCGCCAACCTCAATAATAA
CCTGCCGGAAATGCTGCTCACGCAGTCGGACAGCGGCGTGCGCAATACGCTGTTCGCCTTCGTGCGCCAA
CTGGCCGGGCTGAAGGATTACGTAACGGAAGTGCTGAGTGAAACGCTGGCGACCGGCGACGATCGTGCAT
TTCTGGTGCGCGGCGTGTATGTCAGCTCGGTGTATCAGCAGGGCGTACCGTTTGATGCCTTCGCCCAGTC
CGCTTCCCGGCGTTACCAATTGCCGGAGCCGATCAACGCCGCCATGCGCGGTGAATCCAATACTTTCTTT
GTACAGAAACTGTTCCCGGAGGTGATTTTCCCGGAAGCCAGTCTGGCGGGGGAAAACCGGCTGCACAGCC
TGTATCGCCGTCGCCGCATGAGCATCGGCATTACCTGCATGGTGCTGTTCGGGCTGGCGATGATAGGCAG
TTGGCACCATTTCTACCGGGTGAACGAAGAAGCCGGTCGTAACGTGCTGACCAAGGCGCAGGCGTTCATC
GGCACCAACGAGCTGGAAGGGCAGGCGGGCTACGGTTACCAGCAACTGCCGCGTTTGAATTTGATCCGCG
ACGCGACCCTGTCGTTCGGCAACTACCATGAACGCACGCCGATGATGGCGGATCTTGGCTTGTATCAGGG
CGATAAGATCGGCCCTTACGTGGAAGGTTCCTACCTGCAAATGCTCAACCAGCGTTTCCTGCCGGCGGTG
ATGCAGGGGCTGCTGGAAGACCTGAATCAGGCGCCGGCCGGCAGCGAGCAAAAACTCACTATTTTGCGGG
TGATGCGGATGCTGGACGACGCCTCCGGGCGCAACAAGACGCTGGTGGAGCAGTTCATGGCGCTGCGCTG
GCAGAAGGCGTTCCCCGGTCAGGGCAAGGTGCAGGAACAACTGATGCAGCATCTGGATTACGCGCTGGAG
AGGACCGACTGGCACCAGTCCCGCGAGCAGAAAGACGCGGTGGCGATGTCGACCTTCGCGCCGTTCGTCG
ACCCGATCGCCGCCGCCCAACGCGAGCTGAGCAAGCTGCCGATGTACCAGCGCGTCTACCAGAGTCTGGT
GATGAAAGCGACGCAGGTACTGCCGCCGGATCTGGCTCTCCGCGACGAGGTGGGGCCGACGTTTGACTCG
GTATTCTCGCTGCGTAACGACAAGGCGGGCATGGTGCCGCGGTTGTTGACCTATCCCGGTTTCAGCGATT
TCTACCTCAAGCAGGATAAGACGCTGCTGGACCTGACCGCGTTGGATGCCTGGGTGCTGGGCCAGCGTGA
GCGCGCCCACCTGAGCGAGGCCGACCGCAAGGAAATTCTGCGTCAGGTGAACGATCGCTACATCACCGAC
TACATCAACCAGTGGCAGAAAGTGCTGGCGAATATCGATGTGCAGCCGCTGGAAAGCCCGGAGCAGGCGC
TGAACATTCTGACCGACATTACCGGTAATGATCAGCCGTTTCAGCGGGTGTTGACCACGGTGAGCGACAA
CACCCGCATCCGCAAGCTGGCGGATGACGAAAACGACACCGCGCAGGGCATCAATACCCGTATCGGTCGT
CCGTTCATGACGATTAATGCCGCGCTGAGCGGGCGGGGCGAACAGGGGCCGCTGGTGCAGGAGGTCAATC
AGAAGCTGACCGATCTCTACCACTATCTCGATCAGATTGTGAACGCGACCGATCCGGGGCAGGCGGCGTT
GAAAGCGGTGCAGGCGCGTCAGGGCAACAAGTTCGCCGACCCGGTATTCGCGTTGCAGCAGTATGCCCGC
AGCCTGCCGGCGCCGCTGGACCGCTGGGTCGGCCAACTGGCGGGAGAAAGCGCCAGTCTGGTGACCGGGC
TGGCCATGTCGTCGCTCAATCAGGAGTGGATGGACAAAGTGGTGACGCCGTTCAACGACAAACTGGCCGA
TCGCTACCCGTTCAACCCGTCTTCCGACAAGGATGTGCCGTTGTCCGAGATGGAGCGCTTCTTTGCCGTC
GGCGGGACATTGGACAGCTTCTACCAGACCAACCTCAAGTCGATTATGGACGGCGGCATGTTGGAGGGCG
AAGGCGCATCGCCGTTGCAGACCGAACTGGTGAAACAGCTGGATCGCGCCACCCGTATCCGCCAGACGTT
GTTTAACGCACAAGGCAGCCTGGAAATCCACTTTGTGGTGGAGCCGGTGGAACTGACCGCCAACAAACGC
CGCAGCGTGCTGAACCTGGACGGCCAGTTGCTGGAGTACAGCCACGGACGCCGCACTAAGACGCCGCTGG
TGTGGCCGAACAGTATGCGCGACGGTGCCGAAAGCAAGCTGACGCTGGTGCCGGATGACCGCGAACGCTC
GCCGCGCAGCCTGAGCTTCACCGGCCCGTGGGCGATGTTCCGCCTGTTGACCAACGGCCAACTGACGCAG
GTGAACGACAATACCTTCGACGTGCGTTTCTCGCTGGAACAAGGCGGCATGACCTATCGCGTTTACACCG
ACGCCAGCCACAACCCGTTTGCCGGTGGTCTGTTCAGCCAGTTCAAACTGCCTGATTCTCTCTATTAA
 Primer design