SecReT6
Protein ID: 251793547
SecReT6 ID352
T6SS typei1
Gene symbol-
Locus tagNT05HA_1862
StrainAggregatibacter aphrophilus NJ8700
Repliconchromosome [GenBank: NC_012913] [Browse all T6SS(s) in this replicon]
Location [Strand]1849033..1852530 [+]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDC6AQT0
KEGG IDaap:NT05HA_1862
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 9.50E-75, Aligned region: 467..782
ImcF-related_N [PF14331], Evalue: 2.00E-71, Aligned region: 160..420
DUF1215 [PF06744], Evalue: 6.70E-30, Aligned region: 880..1000
DUF2681 [PF10883], Evalue: 0.0018, Aligned region: 12..54
DUF2681 [PF10883], Evalue: 0.0018, Aligned region: 420..457
Protein Sequence: 1165 a.a.     [Download]
>gi|251793547|ref|YP_003008276.1| type VI secretion protein IcmF [Aggregatibacter aphrophilus NJ8700]
MAKEVGVGSRIIATAIVLLSLAVIAILKLQLKNAKLNKEKNQLEKEQEEQDAILPYIKDQDDSLELMAEA
LKSHLSNKNYIYQLPWYMVIGTKESGKTSFINRSNQKFTLTAFERTSKQYLRKNALYKIDWWASDDAILL
DPEGEMIQQFNTSQDTEGRIAQSLWNHLLDWISDVRPLRPINGIILVVDLPKLIASNHSDRQALAALFRT
RIRDVTEKFGARVPVYVVLNKIDLIEGFETFYSDLKQAERYQNLGFSFTLNTDEHIDDWTKELRDSYDSF
IKEIEEIIFDKLAGTISQEERESLYMYARQLSGMKDILLQFISDVLESDRFTTTPYVRGVYFSSIFQQGI
PMDFYQSALAKQFELPHVVPSYLQERTQRTYFTHNFFSNIIYPEAGLVSDNQKELGRNKRKFVLSSVGVA
ICSIFMVAMWQNFFYQNKTASEKVIKITEEFQQMNISQAMDPTGRNLLKPLNMLRQATYAYGDYEKALPV
IEDFGLYQGKKVGSKVSEAYKKFLGERFLPEIAMGLIEQMDALPDDSNQGLELLRVYRMIDDMANRKAKI
PEQWMAKYLQKNYPKNPDTQRQLMSHFTYAMKYVDPDLSMFDKKIAEKQREYNMLPLADRVYQNFKIFAN
TELQPATNLKTEIGQTFSTIFKVDHNAEDDPSFFKDKNISRSGTLISPLFTDWAYKDFYDPKAVDLLQLA
AIDAWVLGKQQTTNYSKDELATLSNEIRDRYIADYINTWQEALNDLEVVNFVDLRHTVDVLEALTSNEKP
LQKMINLIDKNSEIYPSLADINTDNSTKNPNVATPNQLAALKITEHFAPLTNEVKAGSDSQPHLDDIMKK
LSELKFYMQTIQKSPEPAQTALKAIMAEFNLERTNPVIDLKRLANEAAEPLSTQLNHIADEAWTVELKTA
LSEINKLWNRNVYSFYQSRIANRYPLNRKATQSISLDDFREFFGPNGRVQRFYNDYLKFFLEDNTELSVV
NGESIISPEFLTALQDLQDIQRNYFDGSGNVNVSFSLKPLGLSGKFTASTLNIDGQLLKYSHETPSASRL
IWPNTTRQDVETSLTLISSTGETATLRKTGDWSLFRIFDAASKKANGQSIDLSFKLNGGAINYRLTVENG
TNPFFNHILNEFILPPKLIDTENNNGETQPIEINEEELEDSNIEM
 
Nucleotide Sequence: 3498 bp     [Download]
>ref|NC_012913.1|:1849033-1852530 type VI secretion protein IcmF [Aggregatibacter aphrophilus NJ8700]
ATGGCAAAAGAAGTTGGCGTAGGTAGTCGCATTATTGCAACTGCTATCGTTCTGCTTTCTTTAGCTGTGA
TTGCCATTTTAAAGCTGCAATTAAAGAATGCTAAGTTAAACAAAGAAAAAAATCAGCTAGAAAAGGAACA
AGAAGAACAAGACGCTATTCTACCTTATATTAAAGATCAAGATGATAGTCTTGAATTAATGGCAGAAGCA
TTAAAATCTCATCTCTCAAATAAAAATTATATTTATCAATTACCTTGGTATATGGTAATTGGAACAAAAG
AGTCAGGCAAAACAAGTTTTATTAATCGCTCAAACCAAAAATTCACTTTAACAGCTTTTGAAAGGACATC
TAAGCAATACTTACGGAAAAATGCATTATATAAAATTGACTGGTGGGCAAGTGATGATGCAATCTTGCTT
GATCCTGAAGGTGAAATGATTCAACAATTCAACACAAGCCAAGATACTGAAGGACGAATCGCACAAAGTT
TGTGGAATCATTTACTTGATTGGATCAGTGATGTACGTCCACTACGCCCAATTAACGGTATTATACTTGT
AGTGGATTTGCCTAAATTAATTGCCTCAAATCACAGTGATAGACAAGCATTAGCTGCGCTCTTTCGCACT
CGAATCAGAGATGTGACAGAAAAATTTGGCGCCAGAGTACCAGTATACGTAGTATTGAATAAAATCGACC
TTATTGAAGGCTTTGAAACATTTTACAGTGATCTAAAACAAGCTGAACGCTATCAAAATCTAGGTTTTTC
TTTTACATTAAATACTGATGAGCATATTGATGATTGGACAAAAGAACTAAGAGACAGCTACGACAGTTTT
ATCAAAGAAATTGAAGAAATTATCTTTGATAAACTTGCGGGAACAATATCACAAGAAGAACGTGAATCAT
TGTATATGTACGCTCGTCAATTATCAGGAATGAAAGATATTCTCTTACAATTTATTAGTGATGTATTAGA
AAGCGATCGTTTCACTACAACACCTTATGTACGAGGCGTGTACTTTTCATCTATCTTCCAACAAGGTATC
CCAATGGATTTCTACCAATCTGCGTTAGCTAAGCAGTTTGAGTTACCTCATGTGGTACCAAGTTATCTAC
AAGAAAGAACACAACGCACCTATTTTACACATAATTTCTTCTCAAATATTATTTATCCGGAAGCAGGTCT
TGTTAGTGATAATCAAAAAGAACTAGGGCGGAATAAACGTAAATTTGTATTAAGTTCTGTTGGCGTTGCT
ATATGTTCTATTTTTATGGTAGCAATGTGGCAAAACTTTTTCTATCAAAATAAAACTGCTTCAGAAAAAG
TGATAAAGATTACTGAAGAATTTCAGCAAATGAATATCAGCCAAGCTATGGATCCCACTGGCCGAAATTT
GCTAAAACCGCTAAATATGTTACGTCAGGCCACCTATGCATATGGAGATTATGAAAAAGCACTTCCTGTG
ATTGAGGACTTTGGTTTGTATCAAGGAAAAAAAGTTGGTAGTAAAGTAAGTGAAGCATATAAAAAATTCC
TTGGTGAACGATTCTTACCAGAAATTGCAATGGGCTTAATTGAACAAATGGATGCTTTACCAGATGATAG
TAATCAAGGGCTAGAGCTATTACGCGTATATCGAATGATTGATGATATGGCAAACCGTAAGGCTAAAATC
CCTGAACAATGGATGGCTAAATATCTACAAAAAAACTACCCTAAAAACCCTGATACTCAGCGTCAATTAA
TGTCGCACTTTACTTATGCAATGAAATACGTTGATCCTGATCTCAGTATGTTTGATAAAAAAATTGCAGA
GAAGCAGCGAGAATATAATATGCTTCCTTTAGCTGATCGTGTGTATCAAAACTTTAAAATTTTTGCGAAT
ACAGAATTACAACCTGCCACAAATCTTAAAACAGAAATTGGGCAAACATTTAGTACTATATTTAAAGTAG
ACCATAACGCTGAGGATGATCCTTCATTCTTTAAGGATAAAAACATTAGCCGCTCAGGTACATTAATCAG
TCCTCTATTCACGGATTGGGCGTACAAGGACTTTTATGATCCTAAAGCAGTGGATTTACTTCAACTTGCC
GCGATCGACGCCTGGGTACTTGGCAAACAACAAACAACCAATTATTCAAAAGATGAATTGGCGACCTTAT
CAAATGAAATTCGTGATCGTTACATTGCTGACTATATTAATACTTGGCAAGAAGCATTAAACGACTTAGA
AGTTGTTAATTTTGTAGATTTACGTCATACCGTTGATGTATTAGAGGCATTAACAAGTAATGAAAAACCA
CTACAAAAAATGATTAATTTAATTGATAAAAATAGTGAAATTTATCCAAGTTTGGCTGATATCAATACTG
ATAACTCAACAAAAAATCCAAATGTTGCAACACCAAATCAACTTGCAGCATTAAAAATCACAGAGCATTT
TGCTCCACTAACAAATGAGGTGAAAGCAGGTAGTGATTCACAACCACACCTAGATGATATTATGAAGAAA
TTGTCAGAGCTAAAATTCTATATGCAGACAATTCAGAAATCGCCGGAACCTGCACAAACAGCATTAAAAG
CAATCATGGCTGAATTTAATTTAGAGCGTACAAATCCAGTTATTGATTTAAAACGCCTAGCAAATGAAGC
AGCTGAACCGCTATCCACTCAACTTAATCATATTGCTGATGAAGCATGGACTGTTGAACTCAAAACAGCC
TTAAGCGAAATAAATAAATTATGGAATCGTAACGTTTATAGTTTCTATCAAAGCAGAATTGCGAACCGTT
ATCCATTAAATCGAAAAGCAACACAAAGTATTTCATTAGATGATTTCCGAGAGTTCTTTGGACCTAATGG
CCGAGTACAGAGATTTTATAATGATTACTTGAAATTCTTCTTAGAAGATAATACTGAGCTTTCTGTGGTT
AATGGAGAAAGTATTATTTCACCTGAATTTTTAACCGCACTTCAAGATTTACAAGATATTCAACGTAATT
ACTTTGATGGCTCAGGTAATGTTAATGTATCCTTTAGCCTAAAACCGTTAGGTCTATCAGGTAAGTTTAC
GGCGTCAACGCTAAATATTGATGGACAATTGTTAAAATATAGCCACGAAACACCGTCAGCAAGCCGTCTA
ATTTGGCCAAATACAACGCGTCAAGATGTAGAAACCAGCTTAACATTAATTAGCTCAACAGGTGAAACTG
CAACATTACGCAAAACTGGTGATTGGTCATTATTTAGAATATTTGATGCAGCCAGTAAAAAGGCTAATGG
ACAATCTATCGATCTTTCGTTCAAACTCAACGGCGGAGCAATTAACTATCGTTTAACCGTTGAAAATGGT
ACAAACCCATTCTTCAACCATATACTGAACGAATTCATCTTGCCACCAAAATTAATTGATACTGAAAACA
ACAATGGTGAAACTCAACCAATAGAAATAAATGAAGAAGAACTAGAAGATAGTAATATAGAAATGTAA
 Primer design