SecReT6
Protein ID: 253689608
SecReT6 ID353
T6SS typei1
Gene symbol-
Locus tagPC1_3242
StrainPectobacterium carotovorum subsp. carotovorum PC1
Repliconchromosome [GenBank: NC_012917] [Browse all T6SS(s) in this replicon]
Location [Strand]3653515..3657012 [-]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDC6DCT7
KEGG IDpct:PC1_3242
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 1.00E-92, Aligned region: 267..290
IcmF-related [PF06761], Evalue: 1.00E-92, Aligned region: 505..819
ImcF-related_N [PF14331], Evalue: 1.20E-70, Aligned region: 200..457
DUF1215 [PF06744], Evalue: 3.40E-31, Aligned region: 905..1023
Protein Sequence: 1165 a.a.     [Download]
>gi|253689608|ref|YP_003018798.1| type VI secretion protein IcmF [Pectobacterium carotovorum subsp. carotovorum PC1]
MFKTIITFLRKQLPKLKPSWLLLGVLLWIVVLVLAWWLGPRLVVGESRPLQGIWGRVVFTLVWLWLAFSY
SAWMVWRRVQQMRAERHEQQVIEQDPLQVYVDSQQTFLDRWLEAFQTQLGKRALYAMPWYLTIGLAGSGK
SSLIHRANPANKMNPKLDAELRDVAAGQQVSSWVGESAVIWDPSGQLLAQPELEGDSLGQRYARLWQHLL
QWLSENRRRQPLNGLVLTLDISWLAQAGVADRKAYAQVMRARLQEISVNINTRLPVYIALTRLDMLSGFD
KVYRQLNRDARQAVLGVTFTPQASNGKGWLEELERFWDEWVTHLNDNLPDMLLTQSDRSVRNSLFSFVRQ
LAGVKDYVMEVLTETLATGEDRAFLIRGVYVSSVYQQGVPFDAFAQSASRRYQLPEPINPALRGESNTFF
VQRLFPDVIFPEASLAGENRLHSLYRRRRLSIGVGCMLLASLVLIGSWHHFYRVNEEAGRNVLTKAQAFI
GTNELEGQPGYGYQQLPRLNLIRDATLSFGNYHERTPMLADLGLYQGGKIGPYVEGTYLQMLNQRFLPAV
MQGLLEDLNQAPANSEQKLTILRVMRMLDDASGRNKSLVEQFMAQRWQKAFPGQGNVQEQLMQHLDYALE
HTDWHKAREQKDAVAISTFAPFNQPITLAQQELSKLPMYQRVYQSLVMKATQVLPPDLAIRDEVGPTFDP
VFSLRNDKAGSVPRLLTYPGFSDYYLKQDKALLELTALDAWVLGQRERAQFSEADRREILRQVNDRYITD
YINQWQKVLANIDVQTLDTPEQALDILTDITGNDQPFQRVLTTVSDNTRIRKLADDDNDTAQNINTRIGR
PFMTINAALSGRGEQGPLVQEVNQKLTDLYHYLDQIVNATDPGQAALKAVQARQGNKFADPVFALQQYAR
SLPAPLDRWVGQLAGESASLVTGLAMSSLNQEWLDKVVTPFNEKLADRYPFDPSSNKDVPLSEMEMFFMA
GGTLDSFYQTNLKAMMESGMLEEGMASPLQAELVKQLERATRIRQTLFNAQGSLEVHFVLEPLELTANKR
RSVLNLDGQLLEYSHGRRQKTPLVWPNSMRDGAESKLTLVPDDRERSPRSLSFSGPWAMFRLINSDQLTQ
VNENTFDVRFSLENGAMTYRVYTDASHNPFAGGLFSQFTLPDSLY
 
Nucleotide Sequence: 3498 bp     [Download]
>gi|253686409|ref|NC_012917.1|:c3657012-3653515 Pectobacterium carotovorum subsp. carotovorum PC1, complete genome
ATGTTTAAAACAATCATAACCTTTCTACGCAAGCAGTTGCCTAAACTGAAACCCTCCTGGCTACTTTTGG
GCGTGCTACTGTGGATCGTCGTGCTGGTTCTGGCCTGGTGGCTGGGACCGCGTTTGGTGGTGGGCGAATC
ACGCCCGTTACAGGGAATCTGGGGCCGCGTGGTGTTCACGCTGGTCTGGCTGTGGCTGGCGTTCTCCTAT
AGTGCCTGGATGGTCTGGCGTCGTGTGCAGCAGATGCGTGCAGAGCGTCATGAACAACAGGTAATTGAGC
AGGATCCCCTGCAGGTGTATGTCGATAGCCAGCAGACGTTTCTCGATCGCTGGCTGGAGGCGTTTCAGAC
CCAACTGGGTAAACGCGCACTGTATGCGATGCCCTGGTATCTGACGATTGGTCTGGCTGGCAGCGGGAAA
AGCAGCCTGATCCATCGTGCCAACCCGGCAAACAAAATGAACCCGAAGCTGGATGCGGAACTGCGAGACG
TGGCGGCAGGCCAGCAGGTGAGCAGTTGGGTCGGTGAGTCTGCCGTTATCTGGGACCCCAGCGGACAGCT
ACTCGCGCAGCCTGAACTGGAAGGCGATTCACTCGGACAGCGTTATGCTCGACTGTGGCAGCACCTGCTC
CAGTGGTTGAGTGAAAACCGCCGCCGCCAGCCGCTTAATGGTCTGGTGCTCACGCTGGATATTTCCTGGC
TGGCACAGGCTGGCGTCGCGGATCGCAAAGCTTATGCGCAGGTCATGCGCGCGCGTTTGCAGGAAATTTC
CGTCAACATCAATACGCGTTTACCGGTGTATATCGCGCTGACCCGGCTGGATATGCTGAGCGGCTTCGAT
AAGGTCTATCGCCAGTTAAACCGCGACGCGCGTCAGGCAGTATTAGGGGTGACCTTTACCCCGCAGGCGA
GCAATGGCAAAGGTTGGCTAGAAGAGCTGGAGCGTTTCTGGGATGAGTGGGTCACGCACCTGAATGACAA
CCTGCCAGACATGCTGCTGACGCAGTCCGACAGAAGCGTGCGCAATTCGCTGTTCTCGTTCGTCCGCCAA
CTCGCTGGCGTGAAAGATTATGTGATGGAAGTGCTGACGGAAACGTTAGCGACGGGCGAGGATCGCGCGT
TTCTGATCCGCGGTGTCTATGTGAGTTCTGTCTATCAGCAAGGGGTACCGTTCGACGCCTTTGCGCAGTC
GGCTTCCCGACGCTATCAACTGCCTGAACCGATTAATCCTGCGCTGCGCGGGGAATCCAATACGTTCTTT
GTGCAGCGTCTTTTCCCTGACGTCATCTTCCCTGAAGCCAGTCTGGCAGGTGAAAACCGGCTGCATAGCC
TCTATCGTCGGCGTCGACTGAGCATCGGCGTAGGTTGCATGCTGCTTGCCAGTCTGGTGCTGATTGGCAG
TTGGCACCATTTCTATCGGGTCAATGAAGAGGCCGGACGTAACGTACTGACGAAAGCGCAGGCGTTTATC
GGCACCAATGAACTGGAAGGGCAGCCGGGCTACGGTTATCAGCAGTTGCCGCGGTTGAATTTGATTCGCG
ATGCGACCTTATCTTTTGGTAATTACCACGAACGTACGCCGATGCTGGCCGACCTTGGCCTGTATCAGGG
CGGTAAGATTGGGCCTTATGTTGAAGGCACTTACCTGCAAATGCTGAACCAGCGCTTTCTTCCGGCAGTG
ATGCAAGGGCTGCTGGAGGATTTGAATCAGGCGCCTGCCAATAGTGAGCAAAAGCTGACGATTCTGCGCG
TGATGCGGATGCTGGATGATGCGTCAGGGCGTAATAAATCGCTGGTCGAACAGTTTATGGCGCAGCGTTG
GCAGAAGGCATTTCCCGGTCAGGGCAATGTACAGGAACAGCTGATGCAGCATCTGGATTATGCCCTTGAG
CACACGGATTGGCACAAGGCGCGTGAGCAGAAAGATGCGGTAGCCATCAGCACGTTTGCTCCCTTTAATC
AGCCGATTACGCTGGCCCAGCAGGAACTGAGCAAGCTGCCGATGTATCAGCGCGTTTATCAGAGCCTGGT
CATGAAGGCGACACAGGTGTTGCCGCCGGATTTAGCGATCCGTGATGAGGTTGGGCCGACCTTTGACCCG
GTGTTTTCCCTGCGTAATGACAAAGCGGGAAGTGTGCCGCGACTGCTGACGTACCCCGGCTTTAGTGATT
ATTACCTCAAGCAGGACAAAGCCCTGTTAGAGCTGACGGCGCTGGATGCCTGGGTACTGGGGCAGCGTGA
GCGTGCGCAGTTCAGCGAGGCCGATCGGCGTGAAATTCTGCGTCAGGTTAACGATCGCTACATTACGGAT
TACATCAACCAGTGGCAGAAAGTGCTGGCGAACATTGATGTGCAGACGCTCGATACGCCGGAGCAGGCGC
TCGATATTCTCACGGATATTACCGGCAACGATCAGCCTTTCCAGCGCGTGCTGACGACGGTTAGTGATAA
CACCCGCATTCGTAAGCTGGCCGATGATGACAACGACACGGCGCAGAACATCAATACGCGGATTGGTCGT
CCGTTTATGACCATCAACGCGGCGCTGAGCGGACGTGGTGAGCAAGGGCCGCTGGTGCAAGAGGTCAATC
AGAAGCTGACCGATCTCTATCACTATCTCGATCAGATCGTTAACGCGACCGATCCTGGGCAGGCGGCGTT
GAAAGCGGTGCAGGCGCGGCAGGGAAATAAATTTGCCGATCCGGTATTCGCTTTACAGCAATACGCCCGC
AGCCTTCCCGCACCGCTGGATCGCTGGGTCGGACAGCTCGCCGGAGAGAGCGCGAGTTTGGTGACCGGAC
TGGCAATGTCGTCACTGAATCAGGAATGGCTGGATAAAGTCGTGACGCCATTCAATGAGAAGCTGGCGGA
TCGCTATCCCTTCGACCCGTCATCGAACAAGGATGTGCCGCTGTCGGAAATGGAAATGTTCTTCATGGCT
GGCGGGACGCTGGACAGCTTCTATCAAACCAACCTCAAGGCGATGATGGAAAGCGGCATGCTGGAAGAAG
GCATGGCGTCGCCGTTGCAGGCTGAACTGGTGAAACAGCTTGAACGCGCCACTCGCATCCGCCAGACCCT
GTTTAATGCGCAGGGCAGTCTGGAAGTGCATTTCGTGCTGGAGCCGCTGGAACTGACGGCGAACAAGCGC
CGCAGCGTACTCAATTTGGATGGACAACTGCTGGAATACAGCCACGGTCGTCGCCAGAAAACGCCGTTGG
TATGGCCAAACAGTATGCGTGACGGGGCTGAAAGCAAGCTGACACTGGTGCCGGACGATCGTGAGCGTTC
ACCGCGCAGCCTGAGCTTTAGCGGGCCGTGGGCGATGTTCCGGTTAATCAATAGCGATCAACTGACTCAG
GTTAATGAGAACACCTTTGACGTGCGTTTCTCGCTGGAGAACGGTGCGATGACGTATCGCGTGTATACCG
ATGCCAGCCATAACCCGTTTGCCGGTGGTCTGTTCAGCCAGTTCACGCTGCCTGACTCTCTTTATTAA
 Primer design