SecReT6
Protein ID: 253699835
SecReT6 ID354
T6SS typei4a
Gene symbol-
Locus tagGM21_1205
StrainGeobacter sp. M21
Repliconchromosome [GenBank: NC_012918] [Browse all T6SS(s) in this replicon]
Location [Strand]1409638..1413042 [+]
Producthypothetical protein
NoteTssM
UniProt IDC6E3K1
KEGG IDgem:GM21_1205
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 2.00E-52, Aligned region: 180..417
AAA_16 [PF13191], Evalue: 0.00099, Aligned region: 113..238
AAA_16 [PF13191], Evalue: 0.00099, Aligned region: 813..867
Protein Sequence: 1134 a.a.     [Download]
>gi|253699835|ref|YP_003021024.1| hypothetical protein GM21_1205 [Geobacter sp. M21]
MKKETILVCCKYVLFAAAFVPFLVIAFVMFPLLTWSWRIGAFFPFFVLALWGILALIKKAVLLVRGRRQA
PAAVNPPQPSEEGEARDPLADLQRHWAGGLETLRRSHLSQEGDPLYVLPWFLVLGETGSGKSAALKDARL
CSPFPETEHGAAPTSSCRWVFYDQGVLIDTAGRYAVPVAAERDDAEWRRLLWLLKKHRHVDPLNGVILTL
PADKLARGAREELENYARALRARLDEMIRLLGINFPVYLLITKSDLIEGMEPFCVALPASTLDQPMGLAK
EELSTDLSLFMERFSLGLDEALRRLRLILLQQRAPGAGAASFLLFPDRIRGLYAPLNAFVQAAFGANHYQ
ETPLLRGIYFCSADPAKTPLAPGEPSSSAHPLFLHEFFEKVLPGDRGLWAPGAQALKRQRAVLNWALAGW
GLTGLALCLMLSYSFAKNIRVIRDASQLVSRAQELQGTVPIDLPAMGRLSGMISEVEQRNREWWIPRFGL
DRSKEIELELKARFCSGFRDRFLVFFDRSLADTVSSFSPSTPDQLFGTCVMHLSRRCNLLKARLEGENSR
ALASRPLPDYPLILLHQQAGGPDFGNLYLDYLNWRADREGINKELEWLQLLLKQAYAVKGSDLSWLLEFV
DRLHPEAAITLQQFWAGSRPLPQEPAIPPSLTAKGSERIRAMLAQIAAAHPEPGLLAREKGEFEARYRAA
CFTAWQRFAWDFPKGDQRLVAPKEWRYAAANMASDKGPYLSFMRRALAELQPLAGAGHLPAWVMQMYRFQ
LLRAAGPAAGVASSAAPAAEGVANRLQKLATGKGSGPDGVPGADVTREYLDALARVAPVAKSRSLALQMA
REAFADSQEQNKSPLFIAADAAQRLNALLVQADGDDTFLRLVSGPIAFYGTFVRMETACELQAQWEEKVL
KEVQGANDAQTLQYLLGKDGPVWRYVGQFADPFLGWSPGRGYYARSALGGAVPFSTEFYAFLAKGAKTKI
AASAPTRGSYQVTIKGLPTDANAEARVKPQGTRLELQCAAGSQVISNMNYPVSRPFAWSPDSCGDVLFHI
EIGDTLLTRRYPGTRGFVAFLRDFPGGRHTFYPSHFPAERDALEKMGVRFIRVNYQIFGAGDIPEGEGET
LPGRVPRKVAECWD
 
Nucleotide Sequence: 3405 bp     [Download]
>gi|253698656|ref|NC_012918.1|:1409638-1413042 Geobacter sp. M21 chromosome, complete genome
TTGAAGAAAGAGACCATCCTCGTCTGCTGCAAGTACGTCCTTTTCGCCGCAGCCTTTGTCCCCTTCCTGG
TGATCGCGTTCGTGATGTTTCCGCTCCTCACCTGGTCCTGGCGTATCGGCGCCTTTTTCCCGTTTTTTGT
CCTTGCCCTGTGGGGGATTTTGGCGCTGATCAAAAAAGCGGTGCTCCTGGTGAGGGGGCGGCGGCAGGCG
CCTGCAGCGGTCAACCCTCCGCAACCAAGCGAGGAAGGGGAGGCGCGGGATCCGCTGGCCGACCTGCAGC
GGCACTGGGCGGGTGGGCTGGAGACCTTGAGGCGGTCGCACCTGAGCCAGGAGGGAGACCCGCTCTACGT
GCTCCCCTGGTTCCTGGTCCTTGGCGAGACGGGATCCGGAAAGAGTGCCGCCCTCAAGGACGCCCGGCTT
TGCTCCCCCTTCCCCGAGACGGAGCACGGTGCGGCGCCGACCAGCAGTTGCCGCTGGGTGTTCTACGACC
AGGGGGTGCTGATCGACACAGCCGGTAGATATGCCGTCCCGGTGGCTGCGGAGCGCGACGATGCTGAGTG
GCGCCGGCTTCTGTGGCTGTTGAAGAAACACCGGCACGTAGATCCTCTTAACGGCGTGATCCTGACCCTT
CCCGCGGACAAGCTGGCAAGGGGGGCGCGAGAGGAACTGGAGAACTATGCGCGCGCGCTGCGGGCCCGGC
TAGACGAAATGATCCGCCTGCTCGGCATCAACTTCCCGGTCTACCTCCTGATCACCAAATCCGACCTGAT
CGAGGGGATGGAGCCGTTTTGCGTGGCACTCCCCGCCTCGACGCTCGATCAGCCCATGGGGCTGGCGAAG
GAGGAACTATCGACGGATCTGTCACTGTTCATGGAACGCTTCTCCCTTGGGCTCGACGAGGCGTTGAGAC
GCCTGCGTCTGATCCTTTTGCAGCAAAGGGCACCGGGAGCCGGAGCCGCGAGCTTCCTGCTGTTCCCCGA
CCGGATCCGGGGCCTGTACGCTCCGCTGAACGCCTTCGTGCAGGCGGCATTCGGGGCAAACCACTACCAG
GAGACTCCCCTTTTGCGCGGCATCTACTTTTGCAGCGCCGATCCCGCGAAAACCCCGCTGGCGCCAGGAG
AGCCTTCCTCATCCGCACATCCGCTTTTCCTGCATGAGTTCTTCGAGAAGGTTCTCCCCGGCGACCGGGG
GCTGTGGGCTCCGGGAGCGCAGGCCCTGAAACGGCAGAGGGCGGTACTTAATTGGGCACTCGCCGGCTGG
GGCCTGACCGGACTCGCGCTGTGCCTGATGCTGAGCTATTCCTTCGCGAAAAACATAAGGGTGATCCGGG
ACGCCTCACAGCTGGTGTCGCGCGCGCAGGAGCTGCAGGGAACGGTCCCGATCGACCTGCCGGCGATGGG
ACGTTTGAGCGGCATGATTTCCGAGGTCGAGCAGCGGAACCGGGAGTGGTGGATCCCGCGGTTTGGCCTC
GATCGCAGCAAAGAGATCGAGTTGGAGCTTAAGGCCCGCTTTTGCAGCGGCTTCCGCGACCGCTTCCTGG
TCTTTTTCGACCGCAGCCTTGCCGATACCGTTTCCAGTTTTTCCCCCAGTACCCCGGACCAGCTCTTTGG
AACCTGCGTGATGCACCTCAGCCGACGCTGCAATCTGCTGAAGGCTCGGCTTGAGGGGGAGAACTCGCGG
GCGCTGGCCTCACGGCCGCTTCCCGACTACCCGTTGATATTGCTGCACCAGCAAGCCGGAGGCCCTGACT
TTGGAAACCTCTACCTCGACTACCTCAACTGGCGCGCCGATCGCGAAGGGATCAACAAGGAGCTGGAGTG
GCTGCAATTGCTGCTGAAACAGGCCTATGCCGTGAAGGGAAGCGACCTTTCCTGGCTTTTGGAGTTCGTT
GACCGCCTGCACCCCGAGGCGGCGATAACGCTGCAGCAGTTTTGGGCTGGGTCACGGCCGCTGCCGCAAG
AGCCGGCGATTCCCCCGTCGCTGACGGCCAAAGGAAGTGAGCGGATCCGGGCGATGCTCGCGCAGATAGC
TGCCGCTCATCCCGAGCCGGGGCTACTGGCTAGGGAGAAGGGAGAATTCGAGGCCAGGTACCGCGCCGCC
TGTTTCACCGCATGGCAGCGATTCGCCTGGGACTTTCCGAAAGGGGACCAGCGCCTGGTGGCGCCCAAGG
AGTGGCGCTATGCCGCTGCCAACATGGCGAGTGACAAAGGTCCGTACCTCAGTTTCATGAGGAGGGCTCT
GGCGGAGCTTCAGCCTCTGGCCGGCGCCGGCCATCTTCCCGCCTGGGTCATGCAGATGTACCGTTTCCAG
CTGTTAAGGGCAGCGGGACCTGCTGCCGGCGTCGCATCCTCTGCGGCACCCGCAGCCGAAGGCGTGGCCA
ACCGCCTGCAGAAGTTGGCAACCGGGAAGGGTAGCGGTCCGGACGGGGTTCCCGGCGCCGATGTGACCCG
GGAATATCTCGATGCGTTGGCTCGCGTCGCCCCTGTCGCAAAATCAAGATCGCTCGCGCTCCAGATGGCG
CGGGAGGCGTTCGCCGACTCTCAGGAACAAAACAAGTCGCCGCTTTTCATTGCCGCCGATGCCGCTCAGA
GGCTAAACGCGCTCCTGGTACAGGCTGACGGCGACGACACTTTCCTGCGGCTGGTTTCCGGGCCCATCGC
CTTTTACGGGACCTTCGTCAGGATGGAGACCGCCTGCGAGCTGCAGGCCCAGTGGGAAGAGAAGGTGCTG
AAGGAAGTGCAGGGGGCAAACGACGCCCAGACGCTGCAGTACCTCTTGGGGAAGGACGGCCCTGTCTGGC
GCTATGTCGGCCAGTTCGCGGATCCGTTTCTCGGGTGGAGCCCGGGACGCGGTTACTATGCCCGGTCCGC
CCTCGGGGGGGCGGTCCCCTTCAGCACCGAGTTCTATGCCTTCCTGGCCAAAGGAGCGAAAACGAAGATC
GCTGCCTCCGCCCCCACCAGGGGGAGCTACCAGGTCACCATCAAGGGGCTTCCCACCGACGCCAACGCTG
AGGCGCGCGTGAAGCCGCAGGGGACCCGGCTCGAACTGCAATGCGCGGCAGGTTCGCAGGTGATCTCCAA
CATGAATTACCCCGTGAGCAGGCCCTTCGCCTGGTCGCCCGACAGTTGCGGCGACGTGCTGTTCCACATC
GAGATCGGCGACACGCTCCTCACCAGGCGATATCCCGGGACCCGCGGGTTTGTCGCGTTCCTCAGAGACT
TCCCAGGCGGCAGGCACACCTTTTACCCCAGCCACTTTCCCGCCGAACGCGATGCTTTGGAGAAGATGGG
GGTCCGCTTCATCAGGGTGAACTACCAGATCTTCGGCGCCGGCGATATCCCGGAAGGGGAAGGGGAGACG
CTCCCCGGGCGGGTACCCCGGAAGGTAGCCGAGTGCTGGGATTGA
 Primer design