SecReT6
Protein ID: 253987746
SecReT6 ID355
T6SS typei1
Gene symbol-
Locus tagPAU_00263
StrainPhotorhabdus asymbiotica subsp. asymbiotica ATCC 43949
Repliconchromosome [GenBank: NC_012962] [Browse all T6SS(s) in this replicon]
Location [Strand]289015..289284 [-]
Producthypothetical protein
NotePAAR
UniProt IDB6VM63
KEGG IDpay:PAU_00263
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 8.10E-19, Aligned region: 20..83
DUF4150 [PF13665], Evalue: 1.20E-05, Aligned region: 19..44
DUF4150 [PF13665], Evalue: 1.20E-05, Aligned region: 52..74
Protein Sequence: 89 a.a.     [Download]
>gi|253987746|ref|YP_003039102.1| hypothetical protein PAU_00263 [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
MGNAVKIGDIGTAHDDCEATPVISGSSSVKADGIPLARQGDSLASHSSHPRTIAGGSSTVFIDGKPAART
GDAVSCGGVVIGGGSVNIG
 
Nucleotide Sequence: 270 bp     [Download]
>gi|253987483|ref|NC_012962.1|:c289284-289015 Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949 chromosome, complete genome
ATGGGAAATGCAGTAAAAATAGGTGATATCGGTACAGCACATGATGATTGTGAAGCCACACCGGTGATTT
CCGGCTCCTCCAGTGTAAAAGCCGATGGGATTCCTCTCGCCCGGCAAGGCGATAGTTTAGCCTCGCATTC
CTCTCATCCCCGAACCATTGCAGGCGGCTCCAGCACAGTTTTTATTGACGGCAAACCCGCGGCCAGAACC
GGTGATGCCGTCAGTTGTGGCGGCGTGGTCATAGGTGGCGGCAGCGTCAATATTGGTTAA
 Primer design