SecReT6
Protein ID: 253987756
SecReT6 ID355
T6SS typei1
Gene symbol-
Locus tagPAU_00273
StrainPhotorhabdus asymbiotica subsp. asymbiotica ATCC 43949
Repliconchromosome [GenBank: NC_012962] [Browse all T6SS(s) in this replicon]
Location [Strand]298797..300761 [-]
Producthypothetical protein
NoteTssI
UniProt IDB6VM73
KEGG IDpay:PAU_00273
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 6.60E-63, Aligned region: 28..331
Phage_base_V [PF04717], Evalue: 5.60E-24, Aligned region: 370..462
Protein Sequence: 654 a.a.     [Download]
>gi|253987756|ref|YP_003039112.1| hypothetical protein PAU_00273 [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
MADSGLVFTLSVGNLPAHTFAVVEFTLNEALSTPFSLDATLTSADPDINFKDVLDNSATFSVYRDGLPER
EVTGIVTQFEQSTAGRHRSHYSLTLQPALWRAGLRVNSRIFQHQSITDIIDTLLKENGIRDIVYTLGYEH
PEREFCVQYDESDLAFLHRLLADEGIFYYFEFNQGKNGQTIFFADSCLALGNRFSVPYNPEPDVLGRQGS
IQQFRWREQVGIQGISLRDRTFKNPPWTAEYHFYESKSANQRTDLTSYYHYDFPGRYKDERGEHMSRYRL
EALRRNDLLGHAHSDCFFLWPGLMFTLSHHPKETFNVPWQVISIHHHGRQPQADETRSGDTGTTLTNHFT
FGDRDRSWRPSPYPKPRIDGLQVATVVGPEGEEIFCDEYGRVRVQFAWDQYGQFNDQSSCWIRVSQAWAG
KGWGMIAIPRVGQEVLVDFLHGDPDQPIITGRAYHASNLPPNRLPMAKTQMSIRSKTHKGEGFNELRFED
EKDREEVFIHAQKNLAIQVRNSRDERINYNRTTSIGHDDELVIAHNRKITVEGQQEHKTTGSYIELIERD
KNLVIKGDDIRSVAGTLGYQAEGDITIKSDTRITLRVGNNFVVIHHGGVDIKGTAINLNSAGSPGDVSLP
AMPSVLKAAAALGMPFVAHCSSKE
 
Nucleotide Sequence: 1965 bp     [Download]
>gi|253987483|ref|NC_012962.1|:c300761-298797 Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949 chromosome, complete genome
ATGGCAGATTCAGGACTGGTTTTTACCCTCTCCGTGGGTAACCTCCCAGCTCACACTTTTGCAGTCGTTG
AATTTACACTGAATGAAGCACTCTCGACACCCTTCAGTCTGGACGCCACACTCACCAGCGCTGACCCGGA
TATCAACTTTAAGGATGTTCTGGACAATTCCGCCACCTTCTCCGTCTACCGTGACGGACTCCCGGAACGC
GAAGTCACCGGCATTGTCACCCAGTTTGAACAAAGCACCGCCGGACGCCATCGCAGTCATTATTCCCTGA
CCCTGCAACCCGCACTCTGGCGAGCCGGATTACGCGTCAATTCCCGGATTTTTCAGCATCAATCCATTAC
CGATATTATTGACACCCTGCTGAAAGAAAACGGCATCCGGGATATTGTTTACACCCTCGGCTATGAACAT
CCCGAGCGGGAATTCTGCGTCCAGTACGACGAAAGCGACCTGGCCTTTCTTCACCGCCTGTTAGCCGATG
AAGGCATTTTTTATTACTTCGAGTTTAACCAAGGTAAAAACGGCCAGACCATTTTCTTCGCCGATTCCTG
TCTGGCTCTCGGTAACCGCTTTTCCGTCCCCTATAACCCGGAACCCGATGTGCTGGGCAGGCAGGGCAGT
ATCCAGCAGTTCCGCTGGCGTGAACAGGTCGGGATTCAGGGCATTTCTCTGCGCGACCGCACCTTTAAAA
ACCCGCCCTGGACCGCAGAATATCACTTTTACGAGTCCAAATCGGCCAATCAGCGTACCGATTTAACCAG
CTATTATCACTACGATTTCCCCGGGCGTTATAAAGATGAACGCGGGGAACACATGAGCCGTTATCGTCTG
GAAGCCTTACGCCGCAATGACCTCCTCGGCCATGCACACAGTGACTGCTTTTTCCTCTGGCCGGGCCTCA
TGTTTACCCTCTCTCATCACCCCAAAGAGACATTTAATGTTCCGTGGCAGGTCATCAGCATCCACCACCA
TGGCCGGCAGCCCCAGGCCGATGAAACCCGCTCCGGTGACACGGGAACCACGCTGACCAACCACTTTACC
TTTGGCGACCGTGACCGTTCCTGGCGGCCTTCCCCCTACCCCAAACCCCGCATTGACGGCCTGCAAGTAG
CAACCGTGGTCGGCCCCGAAGGCGAAGAGATCTTTTGTGACGAGTACGGCCGGGTGCGGGTACAGTTTGC
CTGGGATCAATATGGTCAGTTTAATGACCAGAGTTCCTGCTGGATACGGGTCAGTCAGGCATGGGCTGGC
AAAGGCTGGGGCATGATAGCCATCCCACGCGTGGGGCAGGAAGTGCTGGTGGACTTTTTACATGGCGATC
CGGACCAGCCCATTATCACCGGACGCGCTTACCATGCCAGCAACCTCCCTCCCAACCGCCTGCCGATGGC
TAAAACCCAGATGTCAATCCGGTCAAAAACTCACAAAGGAGAAGGCTTTAACGAACTGCGGTTTGAAGAT
GAAAAAGACCGGGAAGAGGTATTTATCCACGCCCAGAAAAACCTGGCCATTCAGGTGCGCAATTCCCGGG
ACGAGCGGATTAACTACAACCGCACCACCAGTATCGGCCACGATGATGAACTGGTGATTGCCCACAACCG
CAAAATAACCGTGGAAGGGCAACAGGAGCATAAAACGACCGGAAGTTATATCGAGTTAATCGAGCGGGAC
AAAAATCTGGTTATAAAAGGCGATGATATCAGATCAGTTGCAGGTACATTAGGTTATCAAGCCGAAGGGG
ATATCACCATAAAAAGTGATACCCGGATAACTTTACGGGTCGGTAACAATTTTGTTGTCATCCATCATGG
GGGGGTAGATATAAAAGGGACTGCAATAAATTTAAACTCAGCGGGAAGCCCAGGTGATGTTTCTTTACCT
GCCATGCCTTCAGTTTTGAAAGCCGCCGCCGCGCTCGGTATGCCATTTGTCGCCCACTGTAGCTCAAAGG
AGTGA
 Primer design