SecReT6
Protein ID: 253987757
SecReT6 ID355
T6SS typei1
Gene symbol-
Locus tagPAU_00274
StrainPhotorhabdus asymbiotica subsp. asymbiotica ATCC 43949
Repliconchromosome [GenBank: NC_012962] [Browse all T6SS(s) in this replicon]
Location [Strand]300795..302141 [-]
Producthypothetical protein
NoteTssA
UniProt IDB6VM74
KEGG IDpay:PAU_00274
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 3.20E-49, Aligned region: 90..154
DUF3702 [PF12486], Evalue: 3.20E-49, Aligned region: 285..432
ImpA-rel_N [PF06812], Evalue: 3.90E-21, Aligned region: 41..101
Protein Sequence: 448 a.a.     [Download]
>gi|253987757|ref|YP_003039113.1| hypothetical protein PAU_00274 [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
MSENPENLIIRAGGNPMNLPAFTAIREEINKINHPSQPAVNWQLIESLALTLFRSHGVDLQSAIYYTLAR
MQLSGLAGFTEGCELLAGVIVSQWDELWPPQPTVRTEMLDWFNTRSGNALRQHDYTTRDLRMIYRAERAL
QLIVDRLQQSDLKRLPKVENLLWFFQNTAKKLENTRIIPKPAAKPVQMPPLVYLANTEPEPAEPEADYDA
SYDSNQPKVQVRFPEPPPRMSALQGFGLGALLGIFVLTGSWLGFYKPLQQQLTALTGTQDGARLNWLYQP
DLQTYEQQLTRLADTSPLVVLQNAEQLTDIAQKTWPLDNKQQHETDRWQQLQAVRLENAPVQGSWHQTRN
QLQQLADKILEQERNRGSFTLSYLKTAIYQIQNSHNREVPLEELLRQFSAAIEQGQTVSPALIKKTDDRF
NALLSRYYALQKDAGLTTQKQPLNPLSQ
 
Nucleotide Sequence: 1347 bp     [Download]
>gi|253987483|ref|NC_012962.1|:c302141-300795 Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949 chromosome, complete genome
ATGAGTGAAAACCCTGAAAACCTGATTATCCGTGCCGGCGGTAACCCAATGAACCTGCCGGCGTTCACCG
CAATACGTGAAGAAATCAATAAAATTAACCATCCCTCTCAACCCGCAGTAAACTGGCAACTGATTGAATC
GCTGGCCCTGACCCTGTTCCGCTCCCACGGCGTCGATTTACAAAGTGCGATTTACTACACCTTGGCCCGG
ATGCAGCTGAGCGGTCTGGCCGGTTTTACCGAAGGCTGCGAATTGCTAGCTGGCGTGATTGTCAGTCAAT
GGGATGAACTATGGCCGCCCCAGCCGACGGTGCGAACCGAGATGCTCGACTGGTTTAACACCCGCAGCGG
CAACGCCCTGCGCCAGCACGATTACACTACGCGCGACCTGCGCATGATTTACCGGGCAGAGCGGGCCTTA
CAGCTGATCGTTGACCGGCTCCAGCAATCCGACCTAAAACGTCTACCCAAAGTTGAAAACCTGCTGTGGT
TTTTCCAAAACACCGCGAAAAAACTGGAAAATACCCGCATCATCCCCAAACCTGCGGCTAAACCGGTACA
GATGCCGCCGCTGGTCTATCTGGCTAATACCGAGCCGGAGCCGGCTGAACCTGAAGCCGACTATGATGCC
AGCTATGACAGCAATCAGCCTAAAGTGCAGGTCCGTTTTCCTGAGCCACCACCCCGGATGAGTGCTTTAC
AGGGCTTCGGGCTGGGTGCATTGCTGGGAATATTTGTCCTGACCGGCAGCTGGCTAGGGTTTTACAAACC
CTTACAACAACAGCTCACCGCCCTGACTGGAACACAAGACGGTGCGAGACTGAACTGGTTATATCAGCCC
GACCTGCAAACCTATGAACAACAGTTAACCCGGTTAGCAGATACCTCACCGCTGGTCGTGTTGCAAAATG
CTGAACAACTAACCGATATAGCGCAGAAAACCTGGCCACTGGACAACAAGCAACAACATGAAACTGACCG
CTGGCAACAATTACAGGCCGTAAGACTGGAGAACGCGCCGGTACAGGGCAGCTGGCACCAGACCCGAAAT
CAACTCCAGCAACTGGCCGATAAAATCCTTGAGCAGGAACGTAACCGGGGCAGTTTCACCCTCTCTTACC
TAAAAACGGCTATCTACCAGATTCAGAACAGCCACAACCGTGAAGTGCCGCTGGAAGAGCTGTTACGCCA
GTTCTCTGCGGCGATAGAACAAGGACAGACCGTCTCACCAGCACTGATAAAAAAGACCGATGACCGCTTT
AACGCTCTGCTGAGTCGTTACTACGCGTTACAAAAAGACGCCGGACTGACCACACAAAAACAACCGCTCA
ATCCGTTAAGTCAATAA
 Primer design