SecReT6
Protein ID: 253987758
SecReT6 ID355
T6SS typei1
Gene symbol-
Locus tagPAU_00275
StrainPhotorhabdus asymbiotica subsp. asymbiotica ATCC 43949
Repliconchromosome [GenBank: NC_012962] [Browse all T6SS(s) in this replicon]
Location [Strand]302194..305739 [-]
Producthypothetical protein
NoteTssM
UniProt IDB6VM75
KEGG IDpay:PAU_00275
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 3.60E-84, Aligned region: 512..826
ImcF-related_N [PF14331], Evalue: 5.80E-66, Aligned region: 209..463
DUF1215 [PF06744], Evalue: 1.60E-37, Aligned region: 920..1039
Protein Sequence: 1181 a.a.     [Download]
>gi|253987758|ref|YP_003039114.1| hypothetical protein PAU_00275 [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
MNWLSLLLKNIKKPTMPRLPPLKATFSLILALLPCLALIWIWWWGPGWQFKQTYPLENLSARWLATAIII
FMVLGFVGTKIWRRLQQLEKLKLDVELKVVDPVLTDIARQDSYLNHWKAQLQRHLGTWDYLYQRPWYLMT
GNTGSGKTSLIQEGYKLTDIAAPDALKGEDGLPLHLRCWLGEKAVILDPDGFLIDQTAMSDSDKPQLPAR
LWQALLTWLTENRQRQPLNGIILTVDTHRLLTDNKEQRERYIAALHLRLQDLRLTLHNHLPFYLVLTKLD
LLHGFGAAFQSLDRPQRAQILGVTFSLNAADEDGWRTELAQFWHQWMQQLNAAMPDMMLNKVDSSQRGPL
FSFTRQIQGLHSYLVQLLDGLLYNGGPAQPGLRGVYLTSSKQIGQMDDPFTQSAAVQYHLGPQAFPTWPV
ADTAPYFTRALFEEVLLAEPNLAAENRLWLSRNRRKLLTFSTAGSVVALALWTGWHYYYQKNYRAGEEVL
TQAKNFLSVPPPKGEDRNGNLQLPLLNPVRQATLAYGDYHHKGLLADMGLYQGSDVGPYVESTYLQLLSQ
RFLPALMNGLLDDLNNAPKGSEEKLEVLRIIRMLEDGSGRNKSLVEQYMQERWSRTFNGQRPVQEQLLTH
LDYALDHTDWRAAREAGDPAAISSFAPYKLPLTNAQKELSQLSIYQRVYQNLRLKAQDSLPPPLNLRDQI
GPSFDSIFIANNDKQLIIPQFLTMNGLNNYFVKQDDQLIDLTVMDSWVLNLSHNVQYSETDRKEIQRQIT
EQYLGDYTATWRSAMNNLDILDFTDIPQAISAIEQVISGEQPISRALQILSDNTRLPVINDTLPAKEQQQ
LRDAPDYRLLVRINREFAPETAVLMEYGEKNSTLQEVYQKLTALHRYLLAIQNAPVPGKAALKAVQLRLE
QNNSDPIFDVQQLAKNLPEPLNRWVGELAEQAWRVVMMEAVRSLEVEWHDSVVKQYQTYLAGRYPFNPDA
TQDVPLSEFDRFFRPGGTLDAFYQQNLKPFVENNLTYSDDGKQLIRPDVLAQLKLADRIRDTFFTPQNGL
GTQFAIEPISLTGNKRRSLLNLDGQLLDYAHGRSSIVHLVWPNSMRSGVESQLTLIPDTSGKSPRSISFT
GPWAQLRLINSGKLTNVRQDSFDVLFSVDGGDMTYRIYVDESDNPFAGGLFSRFKLPDTLY
 
Nucleotide Sequence: 3546 bp     [Download]
>gi|253987483|ref|NC_012962.1|:c305739-302194 Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949 chromosome, complete genome
ATGAACTGGCTCTCTCTTCTTCTAAAAAATATCAAAAAACCGACGATGCCGCGTCTGCCACCTCTCAAAG
CCACATTCTCGCTGATACTGGCTCTCCTGCCCTGCCTGGCCCTTATCTGGATATGGTGGTGGGGGCCTGG
CTGGCAATTCAAACAAACTTACCCGCTGGAAAATCTCTCTGCCCGCTGGTTGGCAACCGCAATCATCATC
TTTATGGTGCTGGGTTTTGTCGGCACAAAAATCTGGCGTCGCTTGCAACAGCTGGAAAAATTAAAACTGG
ATGTGGAATTGAAAGTGGTTGATCCAGTACTGACCGATATTGCTCGTCAGGACAGCTACCTCAACCACTG
GAAAGCGCAACTTCAACGCCATCTCGGCACCTGGGATTACCTTTATCAACGCCCCTGGTACCTCATGACT
GGCAACACTGGCAGCGGCAAAACTTCGCTTATCCAGGAAGGTTACAAATTAACTGACATTGCCGCGCCAG
ACGCTCTGAAAGGAGAAGACGGTCTTCCACTGCACCTGCGCTGTTGGCTAGGGGAAAAAGCAGTCATTCT
CGACCCAGACGGTTTCCTCATTGACCAAACAGCCATGTCGGATAGCGATAAGCCTCAACTGCCCGCCCGC
CTGTGGCAAGCCCTGCTTACCTGGTTGACCGAAAACCGTCAGCGTCAGCCCCTTAATGGTATTATCCTAA
CAGTGGATACCCACCGTTTACTGACCGACAACAAAGAACAGCGTGAACGGTATATCGCAGCGCTCCACCT
GCGCCTGCAAGATCTGCGGTTAACCTTACACAACCATCTTCCCTTTTATCTGGTACTGACTAAACTCGAT
TTGCTACATGGCTTCGGTGCCGCATTCCAATCACTGGACAGACCGCAGCGCGCGCAGATCCTGGGGGTCA
CTTTCAGCCTGAACGCCGCGGATGAAGACGGCTGGCGCACCGAGCTAGCACAATTCTGGCACCAGTGGAT
GCAGCAACTTAACGCCGCGATGCCGGATATGATGCTCAACAAAGTGGATAGCAGCCAACGCGGCCCGCTA
TTCAGCTTTACCCGTCAAATTCAAGGACTGCACAGCTATCTGGTACAGCTACTGGATGGCTTGCTCTACA
ACGGCGGACCGGCACAACCTGGGCTGCGCGGCGTTTATCTCACTTCGTCGAAACAAATCGGTCAGATGGA
TGACCCCTTCACCCAATCTGCCGCCGTGCAGTATCATCTGGGACCTCAGGCATTTCCAACCTGGCCGGTC
GCCGATACCGCCCCCTATTTCACTCGCGCGCTGTTTGAAGAGGTCCTGCTGGCCGAGCCCAATCTGGCTG
CGGAGAACCGACTCTGGTTAAGTCGGAACCGCCGAAAACTGCTGACCTTCTCCACCGCCGGCTCAGTCGT
GGCACTGGCCCTATGGACCGGTTGGCACTACTACTATCAGAAAAACTACCGGGCCGGCGAAGAAGTCCTG
ACGCAGGCTAAAAACTTCTTATCTGTTCCCCCACCCAAAGGGGAAGACCGCAACGGTAATTTACAATTAC
CGCTGCTCAATCCTGTCCGGCAGGCCACCCTTGCCTACGGTGATTACCATCATAAAGGGCTGCTCGCCGA
TATGGGGCTCTATCAGGGCTCGGACGTCGGTCCGTATGTCGAAAGTACCTATCTGCAATTGCTGTCCCAG
CGCTTCCTGCCGGCCCTGATGAACGGCCTGCTGGATGACCTAAACAACGCCCCCAAAGGCAGTGAAGAAA
AACTGGAAGTACTGCGTATCATACGGATGCTGGAAGATGGCAGTGGCCGCAATAAATCGCTGGTTGAACA
GTATATGCAGGAACGCTGGAGTCGCACCTTTAACGGCCAACGTCCGGTGCAGGAACAGCTGTTAACCCAT
CTGGACTACGCTCTGGACCACACCGACTGGCGGGCCGCACGGGAAGCTGGTGACCCAGCAGCTATCAGTA
GCTTCGCGCCTTACAAGCTTCCACTCACTAATGCCCAGAAGGAACTCAGTCAGCTTTCCATTTACCAGCG
GGTCTATCAGAACCTGCGCCTTAAAGCCCAGGACTCTCTGCCACCGCCGCTCAACCTGCGCGACCAGATA
GGTCCTAGTTTTGACAGTATCTTTATCGCCAATAACGACAAGCAACTGATTATCCCTCAGTTTCTGACAA
TGAATGGTCTAAATAACTACTTCGTTAAACAGGACGACCAGCTGATTGACCTCACCGTGATGGACAGTTG
GGTGCTGAACCTGTCACACAACGTCCAGTACAGCGAAACTGACCGTAAAGAAATCCAACGACAAATCACC
GAGCAATATCTTGGCGATTACACCGCCACCTGGCGCAGCGCTATGAACAATCTGGATATCCTCGACTTTA
CCGATATCCCACAGGCCATCAGTGCCATTGAGCAAGTCATCAGTGGGGAACAACCAATCAGCCGGGCGCT
GCAAATCCTCAGCGACAACACCCGCCTGCCAGTGATTAACGATACCCTACCCGCCAAAGAGCAACAGCAG
TTACGCGATGCACCGGACTACCGCCTACTGGTGCGTATCAACCGCGAATTCGCCCCGGAAACTGCCGTAT
TGATGGAATACGGTGAAAAAAACAGCACTCTACAGGAAGTTTACCAGAAACTGACTGCACTACACCGTTA
CCTGTTGGCTATCCAGAACGCACCGGTGCCGGGCAAAGCCGCCCTAAAAGCGGTCCAGTTGCGACTTGAA
CAGAACAACAGTGACCCAATTTTCGACGTGCAACAACTGGCGAAAAACCTGCCGGAACCGCTGAACCGTT
GGGTTGGTGAACTGGCCGAACAGGCATGGCGTGTAGTCATGATGGAAGCCGTCCGCTCATTAGAAGTCGA
ATGGCATGACTCCGTAGTCAAACAGTACCAGACCTATCTGGCCGGACGCTATCCGTTCAACCCGGATGCC
ACTCAGGATGTCCCACTCAGTGAGTTTGACCGCTTCTTCCGACCGGGTGGAACACTCGATGCCTTCTATC
AACAGAACCTGAAACCATTTGTTGAAAACAACCTGACCTACAGCGACGACGGCAAACAACTTATCCGCCC
GGACGTGCTGGCGCAACTGAAACTGGCCGACCGTATCCGCGACACCTTCTTCACCCCGCAAAACGGCCTC
GGTACCCAGTTTGCCATTGAGCCTATCAGCCTGACTGGCAACAAACGCCGCAGCCTGCTCAATCTCGACG
GTCAGTTACTTGATTACGCCCACGGTCGCAGCAGCATCGTGCATTTGGTCTGGCCAAACTCCATGCGCTC
TGGGGTAGAAAGTCAACTCACACTGATACCAGATACCAGCGGCAAATCCCCGCGTTCAATCAGCTTCACC
GGCCCATGGGCCCAGCTGCGACTGATTAACAGCGGCAAACTGACCAACGTGCGTCAGGATTCGTTTGATG
TGCTGTTCTCCGTTGATGGCGGAGATATGACTTACCGTATCTACGTAGATGAATCCGACAACCCGTTTGC
CGGTGGCCTGTTCAGCCGGTTCAAACTGCCTGACACCCTCTATTAA
 Primer design