SecReT6
Protein ID: 253987759
SecReT6 ID355
T6SS typei1
Gene symbol-
Locus tagPAU_00276
StrainPhotorhabdus asymbiotica subsp. asymbiotica ATCC 43949
Repliconchromosome [GenBank: NC_012962] [Browse all T6SS(s) in this replicon]
Location [Strand]305736..307046 [-]
Producthypothetical protein
NoteTssA
UniProt IDB6VM76
KEGG IDpay:PAU_00276
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 7.00E-18, Aligned region: 14..73
ImpA-rel_N [PF06812], Evalue: 7.00E-18, Aligned region: 111..120
Protein Sequence: 436 a.a.     [Download]
>gi|253987759|ref|YP_003039115.1| hypothetical protein PAU_00276 [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
MIKLGSLAHSTINIEEIQRQALQLFSEKSKDFRLMVHLLRTLQHSGNPAELILAMELLADYIKHYWQPAW
PQKPLLKRRLAQQVIKRFDSAQASFCEQADETQREEAQGALAHLAQCWHTDEPALAKEIDQLRSRYARKP
TPKPVAAPAEPTENTAQPTISPALTPAPDIAVDSTSEKAWKQTLLTVADLLCERQPDSPTGYRLRRYATW
HTLTTAPIANGEGKTPLAPISADRTADYLAKLPAADKPLLQQIEQSLTLAPYWLDGHAIAAQAAEKLGYT
AVASAIRDELKAFLDRLPILQTLYFSDMSPFISAATLNWLHPPATAAGNGGSTQDQEAIWQCFQQHGLEA
ALNAAEQHQQQLTEPRDQFYGQLLTAQLLEKAGMTALAQQHYRHLLQAGQHMLLTHWEPGLLAGLAEKAS
INCTSKDTAANRSVNP
 
Nucleotide Sequence: 1311 bp     [Download]
>gi|253987483|ref|NC_012962.1|:c307046-305736 Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949 chromosome, complete genome
ATGATTAAGCTGGGATCACTGGCCCATTCCACCATTAACATTGAAGAAATCCAGCGCCAGGCGCTACAAC
TATTCAGCGAAAAAAGCAAAGATTTCAGGCTGATGGTTCACCTGTTGCGGACACTACAACACAGTGGCAA
CCCCGCAGAGCTAATACTGGCAATGGAACTGCTGGCCGATTACATCAAACATTACTGGCAGCCCGCCTGG
CCACAAAAACCCTTGCTCAAGCGCCGTCTGGCACAACAGGTTATTAAACGCTTTGACTCCGCTCAGGCCA
GCTTCTGTGAACAAGCGGATGAAACTCAACGGGAAGAAGCGCAAGGCGCACTCGCTCATCTGGCGCAATG
CTGGCATACCGATGAACCTGCATTGGCTAAAGAGATCGATCAGTTACGTTCTCGTTATGCCCGCAAACCG
ACACCAAAGCCGGTAGCAGCGCCCGCTGAACCAACAGAAAACACGGCACAACCTACCATTTCCCCAGCGC
TGACCCCAGCACCGGACATCGCGGTAGACAGCACCAGTGAAAAAGCCTGGAAACAGACGTTGCTGACCGT
GGCCGATCTGCTGTGCGAACGCCAGCCTGACTCCCCTACAGGTTACCGGCTGCGCCGCTACGCGACCTGG
CACACACTGACTACTGCACCGATCGCCAACGGCGAAGGCAAAACTCCACTGGCGCCTATTTCAGCAGACC
GTACCGCGGATTATCTGGCGAAACTGCCCGCTGCCGATAAGCCTTTACTGCAACAGATAGAGCAGAGCCT
GACCCTTGCCCCTTACTGGCTTGACGGACATGCTATCGCGGCTCAAGCCGCTGAGAAACTGGGTTATACC
GCAGTTGCCAGCGCTATCCGCGATGAACTGAAAGCATTTCTTGACCGCTTACCCATTTTACAGACCTTAT
ATTTTTCCGATATGAGTCCATTTATTTCAGCTGCAACCCTGAACTGGCTGCACCCCCCAGCAACCGCTGC
GGGCAACGGCGGCTCCACTCAGGATCAAGAGGCTATTTGGCAATGTTTCCAACAACATGGACTGGAAGCA
GCACTCAACGCCGCAGAACAACATCAGCAACAACTGACTGAGCCTCGAGATCAGTTCTACGGTCAACTGC
TTACAGCACAATTGCTTGAAAAGGCGGGTATGACCGCCCTGGCACAACAACATTACCGGCATCTATTGCA
GGCAGGACAGCACATGTTACTCACCCATTGGGAACCCGGCCTGTTGGCAGGACTGGCAGAAAAAGCCTCA
ATTAACTGCACCTCAAAGGATACGGCAGCAAACAGGAGTGTTAACCCATGA
 Primer design